DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pdm3 and Pou1f1

DIOPT Version :9

Sequence 1:NP_001188885.2 Gene:pdm3 / 35813 FlyBaseID:FBgn0261588 Length:1292 Species:Drosophila melanogaster
Sequence 2:NP_032875.1 Gene:Pou1f1 / 18736 MGIID:97588 Length:291 Species:Mus musculus


Alignment Length:320 Identity:99/320 - (30%)
Similarity:144/320 - (45%) Gaps:64/320 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   995 SCGAPTAAGSSATANV-----------LSSINRLNASNGELTITKSLGAPTATATRASSASPRDD 1048
            ||.:.|:|.:..|.|.           .|:...|.|||....:..     |||....|..|..  
Mouse     2 SCQSFTSADTFITLNSDASAALPLRMHHSAAECLPASNHATNVMS-----TATGLHYSVPSCH-- 59

  Fly  1049 SPGPGPSTSSVSHMQPLKLSPSSRSEPPH-LSPNGNDNDNDLLMDSPNEPTINQATTN----VVD 1108
             .|..|||..|   ....|:|.....|.| ||.........||.:.|......|....    |.:
Mouse    60 -YGNQPSTYGV---MAGSLTPCLYKFPDHTLSHGFPPLHQPLLAEDPAASEFKQELRRKSKLVEE 120

  Fly  1109 GIDLD-----EIKEFAKAFKLRRLSLGLTQTQVGQALSVTEGPAYSQSAICSSALAAQMYAAQLS 1168
            .||:|     |:::||..||:||:.||.|||.||:||:...|..:||:.||              
Mouse   121 PIDMDSPEIRELEQFANEFKVRRIKLGYTQTNVGEALAAVHGSEFSQTTIC-------------- 171

  Fly  1169 TQQQNMFEKLDITPKSAQKIKPVLERWMKEAEE--SHWNRYKSGQNHLTDYIGVEPSKKRKRRTS 1231
                 .||.|.::.|:|.|:|.:|.:|::|||:  :.:|. |.|.|          .:||||||:
Mouse   172 -----RFENLQLSFKNACKLKAILSKWLEEAEQVGALYNE-KVGAN----------ERKRKRRTT 220

  Fly  1232 FTPQALELLNAHFERNTHPSGTEITGLAHQLGYEREVIRIWFCNKRQALKNTVRMMSKGM 1291
            .:..|.:.|..||..::.||..||..:|.:|..|:||:|:||||:||..|.....:::.:
Mouse   221 ISVAAKDALERHFGEHSKPSSQEIMRMAEELNLEKEVVRVWFCNRRQREKRVKTSLNQSL 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pdm3NP_001188885.2 Pou 1108..1200 CDD:304656 34/96 (35%)
Homeobox 1228..1281 CDD:278475 23/52 (44%)
Pou1f1NP_032875.1 POU 124..198 CDD:197673 32/92 (35%)
Homeobox 217..270 CDD:278475 23/52 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.