DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pdm3 and ceh-6

DIOPT Version :9

Sequence 1:NP_001188885.2 Gene:pdm3 / 35813 FlyBaseID:FBgn0261588 Length:1292 Species:Drosophila melanogaster
Sequence 2:NP_492304.1 Gene:ceh-6 / 172640 WormBaseID:WBGene00000431 Length:380 Species:Caenorhabditis elegans


Alignment Length:405 Identity:100/405 - (24%)
Similarity:165/405 - (40%) Gaps:100/405 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   906 PTATATRASVSSSSSAGHHGGSLPSGRLSPPSSAPS------------NSAAN----------SI 948
            |::::..:|:|:|:| .....||....:|..:..|:            ..|||          :.
 Worm     4 PSSSSIPSSLSASAS-DSEPSSLNGSGISDQNILPNYHLHHHLINENEMEAANYAQVIKPTCEAF 67

  Fly   949 SDRGYTSPLFRTHSPQGHALSLGGSPRLERDY--LGNG--PSSGTATSTSSCGAPTAAGSSATAN 1009
            .|..:|..|::  .||.|.:    .|:.:..|  |...  |......||::..|.|.|..|:..|
 Worm    68 QDWPHTPMLYQ--QPQLHFM----LPQHDWAYPHLAQSLPPPHHLTPSTAAVAAATIASQSSIIN 126

  Fly  1010 VLSSINRLNASNGELTITKSLGAPTATATRASSASPRDDSPGPGPSTSSVSHMQPLKLSPSSRSE 1074
                                   .|:..|...|...:.:...|    ..:..:.|        ..
 Worm   127 -----------------------QTSVVTSTPSCQIKQEVERP----EIIQRLMP--------PW 156

  Fly  1075 PPHLSPNGNDNDNDLLMDSPNEPTINQATTNVVDGIDL---DEIKEFAKAFKLRRLSLGLTQTQV 1136
            ||....:.:|:.:......|::|     .:::.|..:.   |:::.|||.||.||:.||.||..|
 Worm   157 PPAYQFSCDDSGSVSGAGGPHQP-----LSDISDDSEQTCPDDLEGFAKQFKQRRIKLGYTQADV 216

  Fly  1137 GQALSVTEGPAYSQSAICSSALAAQMYAAQLSTQQQNMFEKLDITPKSAQKIKPVLERWMKEAEE 1201
            |.||....|..:||:.||                   .||.|.::.|:..|:||:|.:|::||:.
 Worm   217 GVALGTLYGNIFSQTTIC-------------------RFEALQLSFKNMCKLKPLLFKWLEEADS 262

  Fly  1202 SHWNRYKSGQNHLTDYIGVEPSKKRKRRTSFTPQALELLNAHFERNTHPSGTEITGLAHQLGYER 1266
            :     ....|...:.:..:..:|||:|||........|..||:.|..|:..|||.:|.:|..|:
 Worm   263 T-----TGSPNSTFEKMTGQAGRKRKKRTSIEVNVKSRLEFHFQSNQKPNAQEITQVAMELQLEK 322

  Fly  1267 EVIRIWFCNKRQALK 1281
            ||:|:||||:||..|
 Worm   323 EVVRVWFCNRRQKEK 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pdm3NP_001188885.2 Pou 1108..1200 CDD:304656 32/94 (34%)
Homeobox 1228..1281 CDD:278475 23/52 (44%)
ceh-6NP_492304.1 POU 188..261 CDD:197673 31/91 (34%)
Homeobox 284..337 CDD:278475 23/52 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3802
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.