DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8701 and CG2127

DIOPT Version :9

Sequence 1:NP_610376.1 Gene:CG8701 / 35812 FlyBaseID:FBgn0033287 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_610375.2 Gene:CG2127 / 35811 FlyBaseID:FBgn0033286 Length:305 Species:Drosophila melanogaster


Alignment Length:236 Identity:97/236 - (41%)
Similarity:117/236 - (49%) Gaps:35/236 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 PKCSD--SSGKGCG----NFTAC----GDPRFAKKPPPKKEDGFQFHHLVKQP---------PEC 81
            ||..|  |:.||||    ..|.|    |..| .||..||||..    :..|.|         |:|
  Fly    74 PKDCDQVSTSKGCGPARFKGTICDAVKGGKR-KKKEEPKKEKS----NKPKLPAKMRSMWYIPDC 133

  Fly    82 CTDPCAERFPPYDQCYYKISDKATRKYQVTWVECPPIKIKPKKICCYEAGIRPPIPRRKRKKFVT 146
            ...|..:....||..:|:||||..|:|||||.|||.:.|||||:|.:....||...||:||..|.
  Fly   134 EYVPKCDVPVRYDIQHYRISDKEARQYQVTWNECPRLVIKPKKVCIHAKRPRPKPCRRQRKTVVA 198

  Fly   147 SAECPT-----NVEC--PTEGGPCPRIKMPGCK-AVDSVSCHVVRRKTDCVKVKAPYPSFSECSR 203
            :|. ||     .:||  ..:..||||..:|.|| |....|||..||.|||.|..|||||||||.|
  Fly   199 TAR-PTMPMLNPMECKKAEDSSPCPRWTLPCCKPARIPPSCHRERRPTDCTKRPAPYPSFSECKR 262

  Fly   204 SRLRKPRGVECNCLDVPSSCDLIRELKK--FEGNPRKPNCG 242
            ..|......||.||.||.:|::..||::  ..|......||
  Fly   263 EELTNAPPTECLCLRVPMACEMWAELRRRIARGKGAVLKCG 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8701NP_610376.1 DUF1431 81..231 CDD:284625 73/157 (46%)
CG2127NP_610375.2 DUF1431 133..290 CDD:284625 73/157 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451845
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005300
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20977
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.