DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8701 and boly

DIOPT Version :9

Sequence 1:NP_610376.1 Gene:CG8701 / 35812 FlyBaseID:FBgn0033287 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_610373.2 Gene:boly / 35809 FlyBaseID:FBgn0050362 Length:255 Species:Drosophila melanogaster


Alignment Length:175 Identity:55/175 - (31%)
Similarity:75/175 - (42%) Gaps:23/175 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 KKEDGFQFHHLVKQPPECCTDPCAERFPPYDQCYYKISDKATRKYQVTWVECPPIKIKPKKICCY 128
            :.:..|.....:.....|.:|.||..:||.|..:||.:||..||||.||.||...:.|.|.:|  
  Fly    78 RSDPEFNVPAFIDSRKRCLSDRCAMAYPPSDLMFYKPTDKLNRKYQRTWCECELQERKRKAVC-- 140

  Fly   129 EAGIRPPIPRRKRKKFVTSAECPTNVEC---------------PTEGGPCPRIKMPGCKAVDSVS 178
                |...|:..|:...|....|:.| |               |.:.. |||.|||.||...:..
  Fly   141 ----RSRPPKIHRRSLRTLPLHPSKV-CSKGNKSLGLGLCRPKPAKSS-CPRFKMPFCKQAITTG 199

  Fly   179 CHVVRRKTDCVKVKAPYPSFSECSRSRLRKPRGVECNCLDVPSSC 223
            |...|..::||:.:..|||||||....|.......|.|::.|..|
  Fly   200 CRPGRPPSNCVRPRTKYPSFSECQPYPLPDVPPTHCFCINQPPMC 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8701NP_610376.1 DUF1431 81..231 CDD:284625 54/158 (34%)
bolyNP_610373.2 DM6 94..251 CDD:214775 54/159 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451849
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005300
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20977
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.