DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8701 and CG33340

DIOPT Version :9

Sequence 1:NP_610376.1 Gene:CG8701 / 35812 FlyBaseID:FBgn0033287 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_996281.1 Gene:CG33340 / 2768682 FlyBaseID:FBgn0053340 Length:229 Species:Drosophila melanogaster


Alignment Length:238 Identity:87/238 - (36%)
Similarity:107/238 - (44%) Gaps:41/238 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 NRVI--PSFASVVCHRAFAKDHNPSPKCSDSSGKGCGNFTA---CGDPRFAKKPPPKKEDGFQFH 72
            :||:  |.|.:|.....||..      |.......|.....   ||.|..  :.||||:     .
  Fly     8 SRVLFRPIFGAVNSCVRFASG------CEKKGPSRCPKVLTKFPCGKPNL--QAPPKKK-----R 59

  Fly    73 HLVKQP-----PECCTDPCAERF-PPYDQCYYKISDKATRKYQVTWVECPPIKIKPKKICCYEAG 131
            .:||..     |.|..|..|..| |.:|..||..||||.|||..|||.||||:||||||||:...
  Fly    60 KMVKAQSMWLNPFCDPDDTACPFNPRFDDIYYVESDKAKRKYWQTWVACPPIQIKPKKICCFAKA 124

  Fly   132 IRPPIPRRKRKKFVTSAECPTNVECPTEGGPCPRI--------KMPGCKAVDSVSCHVVRRKTDC 188
            ...||.|||.....::| ||.....|:| ..|||:        :.|       .||...|....|
  Fly   125 KPAPIKRRKPSAKPSTA-CPQPCPDPSE-DLCPRLARRCHRDGRRP-------PSCRRERGPLPC 180

  Fly   189 VKVKAPYPSFSECSRSRLRKPRGVECNCLDVPSSCDLIRELKK 231
            ||.:.||||||||.|.:...|...|||||..|..|::..|.::
  Fly   181 VKPRTPYPSFSECRRLKPDAPPLKECNCLAKPLLCEIWAEFRR 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8701NP_610376.1 DUF1431 81..231 CDD:284625 68/158 (43%)
CG33340NP_996281.1 DUF1431 73..223 CDD:284625 68/158 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451853
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FCF2
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005300
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20977
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.