DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2127 and CG12860

DIOPT Version :9

Sequence 1:NP_610375.2 Gene:CG2127 / 35811 FlyBaseID:FBgn0033286 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_610979.1 Gene:CG12860 / 36629 FlyBaseID:FBgn0033954 Length:316 Species:Drosophila melanogaster


Alignment Length:306 Identity:96/306 - (31%)
Similarity:130/306 - (42%) Gaps:71/306 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 SSVLRQHLLR-----------------RNYSSQSSADDCGRPKD--CDQVSTSKGCG--PARFKG 93
            ||:||..||.                 |.::  .|.|.|...|.  |:| |..||.|  |...:.
  Fly     7 SSILRPQLLNEVKGLVKSQFLALSQVDRRFA--HSDDRCANKKSRKCEQ-SPPKGVGLPPRDRRH 68

  Fly    94 TICDAV--KGGKRKK-KEEPKK---EKSNKP--------------------------KLPAKMRS 126
            :..|.|  |..|.|| |.|.||   |.:.||                          :|..|...
  Fly    69 SHTDGVSDKCAKNKKDKRECKKFESENAKKPECKPPVVRAPKYYKQLKPCKTDKELSELHPKYLG 133

  Fly   127 MW------YIPDCEYVPKCDVPVRYDIQHYRISDKEARQYQVTWNECPRLVIKPKKVCIHAKRPR 185
            :|      |.|:.:....||:.||.|.::|:.|....|::...|.||  ...|.|:.|   ::..
  Fly   134 VWGRCDIPYKPEPDCTDPCDLAVRLDDKYYKPSKSLDREFDQYWVEC--FFRKQKRCC---RKVA 193

  Fly   186 PKPCRR--QRKTVVATARPTMPMLNPMECKKAEDSSPCPRWTLPCCKPARIPPSCHRERRPTDCT 248
            |:...|  .:|.|.|..:.....:|||.||:...:||||:..|..|.||....:|...||.|.|.
  Fly   194 PERTYRVLTKKCVSAPKKAPCFTVNPMPCKQEAKTSPCPKIKLCECPPAAAINNCKLVRRHTRCR 258

  Fly   249 KRPAPYPSFSECKREELTNAPPTECLCLRVPMACEMW--AELRRRI 292
            :|...|||||||:.|||..:.|.||.||.||..|.::  |.|.||:
  Fly   259 RRACQYPSFSECQHEELNTSRPIECRCLEVPPLCLVYRHALLNRRL 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2127NP_610375.2 DUF1431 133..290 CDD:284625 58/160 (36%)
CG12860NP_610979.1 DM6 148..298 CDD:214775 56/154 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451815
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005300
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20977
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.