DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2127 and boly

DIOPT Version :9

Sequence 1:NP_610375.2 Gene:CG2127 / 35811 FlyBaseID:FBgn0033286 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_610373.2 Gene:boly / 35809 FlyBaseID:FBgn0050362 Length:255 Species:Drosophila melanogaster


Alignment Length:223 Identity:69/223 - (30%)
Similarity:96/223 - (43%) Gaps:50/223 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 KKKEEPKKEKSNKPKLPAK------MRSMWYIPDCEYVPKCDVP---------------VRY--- 145
            ::|:..|.:.::..|:|.|      ||...|  .|...|:.:||               :.|   
  Fly    45 ERKDLKKNDPADNTKVPVKDICWMSMRRSEY--KCRSDPEFNVPAFIDSRKRCLSDRCAMAYPPS 107

  Fly   146 DIQHYRISDKEARQYQVTWNECPRLVIKPKKVCIHAKRPRPKPCRRQRKTVVATARPTMPMLNPM 210
            |:..|:.:||..|:||.||.||.....|.|.||  ..|| ||..||..:        |:|:....
  Fly   108 DLMFYKPTDKLNRKYQRTWCECELQERKRKAVC--RSRP-PKIHRRSLR--------TLPLHPSK 161

  Fly   211 ECKKAEDS------------SPCPRWTLPCCKPARIPPSCHRERRPTDCTKRPAPYPSFSECKRE 263
            .|.|...|            |.|||:.:|.||.| |...|...|.|::|.:....|||||||:..
  Fly   162 VCSKGNKSLGLGLCRPKPAKSSCPRFKMPFCKQA-ITTGCRPGRPPSNCVRPRTKYPSFSECQPY 225

  Fly   264 ELTNAPPTECLCLRVPMACEMWAELRRR 291
            .|.:.|||.|.|:..|..|.:|...|.:
  Fly   226 PLPDVPPTHCFCINQPPMCVVWNYYRMK 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2127NP_610375.2 DUF1431 133..290 CDD:284625 60/186 (32%)
bolyNP_610373.2 DM6 94..251 CDD:214775 56/168 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451827
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005300
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20977
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.