DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2127 and CG11635

DIOPT Version :9

Sequence 1:NP_610375.2 Gene:CG2127 / 35811 FlyBaseID:FBgn0033286 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_610372.1 Gene:CG11635 / 35808 FlyBaseID:FBgn0033283 Length:286 Species:Drosophila melanogaster


Alignment Length:269 Identity:80/269 - (29%)
Similarity:112/269 - (41%) Gaps:63/269 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 SSVLRQHLLRRNYSSQSSADDCGRPKDCDQVSTSKG------------CGPARFKGTICDAVKGG 102
            ||:||....|::.||.........||.....|..|.            |.||.|      ..:|.
  Fly     4 SSLLRGFSSRQSGSSNKPPKPPSPPKPPSSPSPPKSPSAKRECKIRTHCIPAAF------CAEGD 62

  Fly   103 KRKKKEEPKKEKSNKPKLP---AKMRSMWYIPDCEYVPKCDVPV-RYDIQHYRISDKEARQYQVT 163
            |.|...:|  .|:..|..|   ::...:.    ||  |.|..|: .:|..:||.|.|.. .||..
  Fly    63 KFKSMWDP--PKNLPPPYPFVVSRSNDLC----CE--PNCTKPLPSFDELYYRPSCKNG-PYQRH 118

  Fly   164 WNECPRLVIKPKKVCIHAKRPRPKPC-----RRQRKTVVATARPTMPMLNPMECKKAEDSSPCPR 223
            |.|||:.:|:.|.:|.:.|.....|.     ||:|.|:.|||                 :.|||.
  Fly   119 WVECPKFMIRKKIICAYDKLEALSPARRVAERRERTTLSATA-----------------TGPCPH 166

  Fly   224 WT-LPCCKPARIPPSCHRERRPTDCTKRPAPYPSFSECKREELTNAP--PTECLCLRVPMA-CE- 283
            :. |..|.|.|.||.||..:.|:.|.:..||.|.:|:||:.:|...|  |.||.| |.|:: || 
  Fly   167 FAPLARCVPGRRPPRCHAAKTPSCCRRLCAPMPCWSDCKQPKLAKRPYRPRECEC-RFPLSLCEA 230

  Fly   284 ----MWAEL 288
                .|.::
  Fly   231 ERGRQWVKI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2127NP_610375.2 DUF1431 133..290 CDD:284625 58/171 (34%)
CG11635NP_610372.1 DM6 88..235 CDD:214775 57/171 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451843
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005300
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20977
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.