DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2127 and swif

DIOPT Version :9

Sequence 1:NP_610375.2 Gene:CG2127 / 35811 FlyBaseID:FBgn0033286 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001097231.1 Gene:swif / 246569 FlyBaseID:FBgn0050366 Length:284 Species:Drosophila melanogaster


Alignment Length:278 Identity:89/278 - (32%)
Similarity:121/278 - (43%) Gaps:68/278 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 RNYSSQSS--ADDCGRPKD--CDQVSTSKGCGPARFKGTICDAVKGGKRKKKE-EPKKEKS---- 115
            |:::|:.:  ||...:|.|  |..|.:.: |..||  .||...:...:..|:| :.|||:.    
  Fly    24 RSFASKVTYHADPPCQPVDPLCHHVPSGR-CVQAR--ETINLKLPHERLLKQERDQKKERKCCVL 85

  Fly   116 -----------NKPKLPAKM-----RSMWYIPDCE--YVPKC-DVPVRYDIQHYRISDKEARQYQ 161
                       .:|| .||:     ||||. |.|:  ..|.| ::..|:|..:|..|:| .|.||
  Fly    86 RSAAKNPCVEIRRPK-AAKLEEKPFRSMWE-PPCKANEQPFCKEMLPRFDAMYYHPSNK-CRCYQ 147

  Fly   162 VTWNECPRLVIKPKKVC-----------IHAKRPRPKPCRRQRKTVVATARPTMPMLNPMECKKA 215
            .||.||..:..:.||||           ...:.|.|..|:...|     ||..:       |...
  Fly   148 RTWVECSPVKKRLKKVCCLDAIEPPEILYRIRPPCPGTCQINYK-----ARRLL-------CADG 200

  Fly   216 E-DSSP---CPRWTLPCCKPARIPPSCHRERRPTDCTKRPAPYPSFSECKREELTNAPP---TEC 273
            | :..|   ||::..||||.||..|.|.|.|:||.|||..||||    |..|::....|   .||
  Fly   201 EWERDPTRKCPKFFHPCCKLARCNPRCSRGRKPTLCTKLRAPYP----CYSEKIRGTRPLRKREC 261

  Fly   274 LCLRVPMACEMWAELRRR 291
            |||.....|...||..||
  Fly   262 LCLETTPKCIALAERMRR 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2127NP_610375.2 DUF1431 133..290 CDD:284625 60/177 (34%)
swifNP_001097231.1 DUF1431 121..278 CDD:284625 59/173 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451844
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005300
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20977
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.