DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2127 and cola

DIOPT Version :9

Sequence 1:NP_610375.2 Gene:CG2127 / 35811 FlyBaseID:FBgn0033286 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_724673.1 Gene:cola / 246566 FlyBaseID:FBgn0050363 Length:259 Species:Drosophila melanogaster


Alignment Length:231 Identity:73/231 - (31%)
Similarity:107/231 - (46%) Gaps:37/231 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 SSQSSADDCGRPKDCDQVSTSKG---CGPARFKGTIC-----DAVKGGKRKKKEEPKKEKSNKPK 119
            |..:|:.:|.:.:|.|..:...|   | |.:::...|     .||:...:..:|...:.|:|   
  Fly    27 SYDASSGECCKMRDKDTTACKDGKWFC-PVKYEPNKCYEKPSFAVEEYSQYLQEIYNRGKTN--- 87

  Fly   120 LPAKMRSMWYIPDCEYVPKCDVPVRYDIQHYRISDKEARQYQVTWNECPRLVIKPKKVCIHAKRP 184
                       |||  :.|.   :|:|.:||:.|||: |::|.||.|||.|.::||..|...:..
  Fly    88 -----------PDC--LLKL---IRHDAEHYKPSDKQ-RKFQRTWPECPLLWLRPKDYCCPDQEV 135

  Fly   185 RPKPCRRQRKTVVATARPTMPMLNPMECKKAEDSSPCPRWTLPCCKPARIPPSCHRERRPTDCTK 249
            .....||.|.       |..|.|:.:|....:.|..|.....||||..|.||.|.:.|||::|.|
  Fly   136 YQPMNRRIRP-------PQEPPLSAIEKHLFQMSIFCKSVRAPCCKVGRRPPKCTKPRRPSECCK 193

  Fly   250 RPAPYPSFSECKREELTNAPPTECLCLRVPMACEMW 285
            :..|.|||||..|..:.....:||.| |....||||
  Fly   194 KFTPMPSFSEACRHLIPRFCGSECAC-RGGSLCEMW 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2127NP_610375.2 DUF1431 133..290 CDD:284625 57/153 (37%)
colaNP_724673.1 DM6 84..232 CDD:214775 61/173 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451842
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005300
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20977
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.