DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment boly and CG12860

DIOPT Version :9

Sequence 1:NP_610373.2 Gene:boly / 35809 FlyBaseID:FBgn0050362 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_610979.1 Gene:CG12860 / 36629 FlyBaseID:FBgn0033954 Length:316 Species:Drosophila melanogaster


Alignment Length:243 Identity:67/243 - (27%)
Similarity:96/243 - (39%) Gaps:60/243 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 ATERKDLK--KNDPADNTKVPVKDICWMSMRRSEYKCRSDPEFNVPAFIDSRKRCLSD------- 98
            |..:||.:  |...::|.|.|              :|: .|....|.:....|.|.:|       
  Fly    79 AKNKKDKRECKKFESENAKKP--------------ECK-PPVVRAPKYYKQLKPCKTDKELSELH 128

  Fly    99 --------RCAMAYPPS-------------DLMFYKPTDKLNRKYQRTWCECELQERKRKAVCRS 142
                    ||.:.|.|.             |..:|||:..|:|::.:.|.||..  ||:|..||.
  Fly   129 PKYLGVWGRCDIPYKPEPDCTDPCDLAVRLDDKYYKPSKSLDREFDQYWVECFF--RKQKRCCRK 191

  Fly   143 RPPKIHRRSLRTLPLHPSKVCSKGNKSLGLGLCRPKPAK-----SSCPRFKMPFCKQAIT-TGCR 201
            ..|:   |:.|.|    :|.|....|........|.|.|     |.||:.|:..|..|.. ..|:
  Fly   192 VAPE---RTYRVL----TKKCVSAPKKAPCFTVNPMPCKQEAKTSPCPKIKLCECPPAAAINNCK 249

  Fly   202 PGRPPSNCVRPRTKYPSFSECQPYPLPDVPPTHCFCINQPPMCVVWNY 249
            ..|..:.|.|...:||||||||...|....|..|.|:..||:|:|:.:
  Fly   250 LVRRHTRCRRRACQYPSFSECQHEELNTSRPIECRCLEVPPLCLVYRH 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bolyNP_610373.2 DM6 94..251 CDD:214775 56/190 (29%)
CG12860NP_610979.1 DM6 148..298 CDD:214775 50/159 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451826
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F9I4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005300
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20977
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.