DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment boly and CG11635

DIOPT Version :9

Sequence 1:NP_610373.2 Gene:boly / 35809 FlyBaseID:FBgn0050362 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_610372.1 Gene:CG11635 / 35808 FlyBaseID:FBgn0033283 Length:286 Species:Drosophila melanogaster


Alignment Length:180 Identity:48/180 - (26%)
Similarity:70/180 - (38%) Gaps:37/180 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 EYKCRSDPEFNVP---AFIDSRKR--CLSDRCAMAYPPSDLMFYKPTDKLNRKYQRTWCECELQE 133
            ::|...||..|:|   .|:.||..  |....|....|..|.::|:|:.| |..|||.|.||....
  Fly    63 KFKSMWDPPKNLPPPYPFVVSRSNDLCCEPNCTKPLPSFDELYYRPSCK-NGPYQRHWVECPKFM 126

  Fly   134 RKRKAVCRSRPPKIHRRSLRTLPLHPSKVCSKGNKSLGLGLCRPKPAKSSCPRFKMPFCKQAITT 198
            .::|.:|..  .|:.       .|.|::..::..:...|......|    ||.| .|..:     
  Fly   127 IRKKIICAY--DKLE-------ALSPARRVAERRERTTLSATATGP----CPHF-APLAR----- 172

  Fly   199 GCRPGRPPSNCVRPRT---------KYPSFSECQPYPLPDVP--PTHCFC 237
             |.|||.|..|...:|         ..|.:|:|:...|...|  |..|.|
  Fly   173 -CVPGRRPPRCHAAKTPSCCRRLCAPMPCWSDCKQPKLAKRPYRPRECEC 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bolyNP_610373.2 DM6 94..251 CDD:214775 40/157 (25%)
CG11635NP_610372.1 DM6 88..235 CDD:214775 40/155 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451847
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005300
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20977
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.