DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment boly and CG33340

DIOPT Version :9

Sequence 1:NP_610373.2 Gene:boly / 35809 FlyBaseID:FBgn0050362 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_996281.1 Gene:CG33340 / 2768682 FlyBaseID:FBgn0053340 Length:229 Species:Drosophila melanogaster


Alignment Length:250 Identity:73/250 - (29%)
Similarity:98/250 - (39%) Gaps:63/250 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LFDPYEFGAPTMATE-RKDLKKNDPADNTKVPVKDICWMSMRRSEYKCRSDPEFNVPAFIDSRKR 94
            ||.|. |||...... ....:|..|:...||..|..|            ..|....|   ..:||
  Fly    11 LFRPI-FGAVNSCVRFASGCEKKGPSRCPKVLTKFPC------------GKPNLQAP---PKKKR 59

  Fly    95 -------------CLSDRCAMAYPPS-DLMFYKPTDKLNRKYQRTWCECELQERKRKAVC---RS 142
                         |..|..|..:.|. |.::|..:||..|||.:||..|...:.|.|.:|   ::
  Fly    60 KMVKAQSMWLNPFCDPDDTACPFNPRFDDIYYVESDKAKRKYWQTWVACPPIQIKPKKICCFAKA 124

  Fly   143 RPPKIHRRSLRTLPLHPSKVCSKGNKSLGLGLCRPKPAKSSCPRF--------KMPFCKQAITTG 199
            :|..|.||....   .||..|.:.        | |.|::..|||.        :.|       ..
  Fly   125 KPAPIKRRKPSA---KPSTACPQP--------C-PDPSEDLCPRLARRCHRDGRRP-------PS 170

  Fly   200 CRPGRPPSNCVRPRTKYPSFSECQPYPLPDVPP-THCFCINQPPMCVVWNYYRMK 253
            ||..|.|..||:|||.|||||||:... ||.|| ..|.|:.:|.:|.:|..:|.:
  Fly   171 CRRERGPLPCVKPRTPYPSFSECRRLK-PDAPPLKECNCLAKPLLCEIWAEFRRR 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bolyNP_610373.2 DM6 94..251 CDD:214775 57/182 (31%)
CG33340NP_996281.1 DUF1431 73..223 CDD:284625 56/169 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451828
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005300
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20977
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.