DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment boly and swif

DIOPT Version :9

Sequence 1:NP_610373.2 Gene:boly / 35809 FlyBaseID:FBgn0050362 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001097231.1 Gene:swif / 246569 FlyBaseID:FBgn0050366 Length:284 Species:Drosophila melanogaster


Alignment Length:258 Identity:65/258 - (25%)
Similarity:95/258 - (36%) Gaps:68/258 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 TSRTIQVRME-SLFDPYEFGAPTMATERKDLKKNDPADNTKVPVKDICWMSMRRSEYKCRSDP-- 81
            :.|.:|.|.. :|..|:|    .:..:.:|.||.......:...|:.|....|....|....|  
  Fly    50 SGRCVQARETINLKLPHE----RLLKQERDQKKERKCCVLRSAAKNPCVEIRRPKAAKLEEKPFR 110

  Fly    82 -------EFNVPAFIDSRKRCLSDRCAMAYPPSDLMFYKPTDKLNRKYQRTWCECELQERKRKAV 139
                   :.|...|           |....|..|.|:|.|::|. |.|||||.||...:::.|.|
  Fly   111 SMWEPPCKANEQPF-----------CKEMLPRFDAMYYHPSNKC-RCYQRTWVECSPVKKRLKKV 163

  Fly   140 C------------RSRPP-----KIHRRSLRTLPLHPSKVCSKGNKSLGLGLCRPKPAKSSCPRF 187
            |            |.|||     :|:.::.|.|       |:.|...        :.....||:|
  Fly   164 CCLDAIEPPEILYRIRPPCPGTCQINYKARRLL-------CADGEWE--------RDPTRKCPKF 213

  Fly   188 KMPFCKQA-ITTGCRPGRPPSNCVRPRTKYPSFSE----CQPYPLPDVPPTHCFCINQPPMCV 245
            ..|.||.| ....|..||.|:.|.:.|..||.:||    .:|     :....|.|:...|.|:
  Fly   214 FHPCCKLARCNPRCSRGRKPTLCTKLRAPYPCYSEKIRGTRP-----LRKRECLCLETTPKCI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bolyNP_610373.2 DM6 94..251 CDD:214775 49/174 (28%)
swifNP_001097231.1 DUF1431 121..278 CDD:284625 50/183 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451848
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005300
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20977
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.