DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment boly and cola

DIOPT Version :9

Sequence 1:NP_610373.2 Gene:boly / 35809 FlyBaseID:FBgn0050362 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_724673.1 Gene:cola / 246566 FlyBaseID:FBgn0050363 Length:259 Species:Drosophila melanogaster


Alignment Length:283 Identity:77/283 - (27%)
Similarity:106/283 - (37%) Gaps:81/283 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMLAKNTLSRAPVAIRSGLTSRTIQVRMESLFDPYEFGAPTMATERKDLKKNDPADNTKVPVKDI 65
            |:.:|..|.||.:. |..:|||.           |.:|:.. |:..:..|..| .|.|  ..||.
  Fly     1 MITSKLRLRRAQIP-RFSITSRW-----------YNWGSYD-ASSGECCKMRD-KDTT--ACKDG 49

  Fly    66 CWM-SMRRSEYKCRSDPEFNVPAF------IDSRKRCLSDRCAMAYPPSDLMFYKPTDKLNRKYQ 123
            .|. .::....||...|.|.|..:      |.:|.:...| |.:.....|...|||:|| .||:|
  Fly    50 KWFCPVKYEPNKCYEKPSFAVEEYSQYLQEIYNRGKTNPD-CLLKLIRHDAEHYKPSDK-QRKFQ 112

  Fly   124 RTWCECELQERKRKAVC------------RSRPPKIHRRSLRTLPLHPSKVCSKGNKSLGLGLCR 176
            |||.||.|...:.|..|            |.|||:                              
  Fly   113 RTWPECPLLWLRPKDYCCPDQEVYQPMNRRIRPPQ------------------------------ 147

  Fly   177 PKPAKSSCPR--FKMP-FCKQAITTGCRPGRPPSNCVRPR---------TKYPSFSECQPYPLPD 229
             :|..|:..:  |:|. |||......|:.||.|..|.:||         |..|||||...:.:|.
  Fly   148 -EPPLSAIEKHLFQMSIFCKSVRAPCCKVGRRPPKCTKPRRPSECCKKFTPMPSFSEACRHLIPR 211

  Fly   230 VPPTHCFCINQPPMCVVWNYYRM 252
            ...:.|.| ....:|.:||.|.|
  Fly   212 FCGSECAC-RGGSLCEMWNTYNM 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bolyNP_610373.2 DM6 94..251 CDD:214775 49/180 (27%)
colaNP_724673.1 DM6 84..232 CDD:214775 49/181 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451846
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005300
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20977
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.