DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11635 and CG12860

DIOPT Version :9

Sequence 1:NP_610372.1 Gene:CG11635 / 35808 FlyBaseID:FBgn0033283 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_610979.1 Gene:CG12860 / 36629 FlyBaseID:FBgn0033954 Length:316 Species:Drosophila melanogaster


Alignment Length:286 Identity:73/286 - (25%)
Similarity:97/286 - (33%) Gaps:84/286 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SSLLRGFSSRQSGSSNKPPK--PPSPPK----PPS----------SPSPPKSPSAKRECK----- 47
            |.:.|.|:......:||..:  ..||||    ||.          |....|:...|||||     
  Fly    30 SQVDRRFAHSDDRCANKKSRKCEQSPPKGVGLPPRDRRHSHTDGVSDKCAKNKKDKRECKKFESE 94

  Fly    48 --IRTHCIPAAFCAEGDKFKSMWDPPK------NLPPPYPFVVSRSNDLCC------EPNCTKPL 98
              .:..|.|..  ....|:.....|.|      .|.|.|..|..|     |      ||:||.|.
  Fly    95 NAKKPECKPPV--VRAPKYYKQLKPCKTDKELSELHPKYLGVWGR-----CDIPYKPEPDCTDPC 152

  Fly    99 P---SFDELYYRPS-CKNGPYQRHWVECPKFMIRKKIICAYDKLEALSPARRVAERRERTTLS-- 157
            .   ..|:.||:|| ..:..:.::||||  |..::|..|           |:||..|....|:  
  Fly   153 DLAVRLDDKYYKPSKSLDREFDQYWVEC--FFRKQKRCC-----------RKVAPERTYRVLTKK 204

  Fly   158 --------------------ATATGPCPHFAPLARCVPGRRPPRCHAAKTPSCCRRLCAPMPCWS 202
                                ...|.|||.. .|..|.|......|...:..:.|||.....|.:|
  Fly   205 CVSAPKKAPCFTVNPMPCKQEAKTSPCPKI-KLCECPPAAAINNCKLVRRHTRCRRRACQYPSFS 268

  Fly   203 DCKQPKLAKRPYRPRECECRFPLSLC 228
            :|:..:|  ...||.||.|.....||
  Fly   269 ECQHEEL--NTSRPIECRCLEVPPLC 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11635NP_610372.1 DM6 88..235 CDD:214775 45/173 (26%)
CG12860NP_610979.1 DM6 148..298 CDD:214775 42/161 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451835
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005300
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20977
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.