DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11635 and CG12861

DIOPT Version :9

Sequence 1:NP_610372.1 Gene:CG11635 / 35808 FlyBaseID:FBgn0033283 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_610978.2 Gene:CG12861 / 36628 FlyBaseID:FBgn0033953 Length:239 Species:Drosophila melanogaster


Alignment Length:202 Identity:53/202 - (26%)
Similarity:77/202 - (38%) Gaps:48/202 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 CIPAAFCAEGDKFKSMWDPPKNLPPPYPFVVSRSNDLCCEPNCTKPLPSFDELYYRPSCKNG-PY 115
            |..||  :..||        |..||..|.....    |.:..|.:.....|..:|.||.|.. .|
  Fly    52 CYKAA--SRNDK--------KCHPPVLPLPKME----CIDDPCAESEMPLDLDHYTPSDKAARKY 102

  Fly   116 QRHWVEC---PKFMIRKK------------------IICAYDKLEALSPARRVAERRERTTLSAT 159
            ||.|.||   ||..::.:                  :.|.:|.:    |...|.::.| ..:...
  Fly   103 QRTWCECYMIPKAAVKARKCYPNRPRRKFECPRVSDVECRWDPM----PCDDVKKKPE-ILIEVP 162

  Fly   160 ATG--PCPHFAPLARCVPGRRPPRCHAAKTPSCCRRLCAPMPCWSDCKQPKLAKRPYRPRECECR 222
            ..|  ||... |...|..||.||.|.|.:.|:||::.....|.:|:||:..|...|    .|||.
  Fly   163 RIGKWPCCKI-PTPGCRDGRIPPSCDAGRIPTCCKKRRTKYPSFSECKKELLDPIP----PCECE 222

  Fly   223 FPLSLCE 229
            ..:::|:
  Fly   223 KKVNMCD 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11635NP_610372.1 DM6 88..235 CDD:214775 44/166 (27%)
CG12861NP_610978.2 DM6 74..235 CDD:214775 44/170 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451839
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005300
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20977
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.