DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11635 and CG8701

DIOPT Version :9

Sequence 1:NP_610372.1 Gene:CG11635 / 35808 FlyBaseID:FBgn0033283 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_610376.1 Gene:CG8701 / 35812 FlyBaseID:FBgn0033287 Length:246 Species:Drosophila melanogaster


Alignment Length:227 Identity:66/227 - (29%)
Similarity:91/227 - (40%) Gaps:59/227 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SPSPPKSPSAKRECKIRTHCIPAAFCAEGDKFKSMWDPPK-----------NLPPPYPFVVSRSN 86
            :|||..|.|:.:.|...|.|        ||...:...|||           ..||.         
  Fly    33 NPSPKCSDSSGKGCGNFTAC--------GDPRFAKKPPPKKEDGFQFHHLVKQPPE--------- 80

  Fly    87 DLCCEPNCTKPLPSFDELYYRPSCK-NGPYQRHWVECPKFMIRKKIICAYDK-LEALSPARRVAE 149
              ||...|.:..|.:|:.||:.|.| ...||..|||||...|:.|.||.|:. :....|.|    
  Fly    81 --CCTDPCAERFPPYDQCYYKISDKATRKYQVTWVECPPIKIKPKKICCYEAGIRPPIPRR---- 139

  Fly   150 RRERTTLSA---------TATGPCPHFAPLARCVPGRR---PPRCHAAKTPSCCRRLCAPMPCWS 202
            :|::...||         |..||||...     :||.:   ...||..:..:.|.::.||.|.:|
  Fly   140 KRKKFVTSAECPTNVECPTEGGPCPRIK-----MPGCKAVDSVSCHVVRRKTDCVKVKAPYPSFS 199

  Fly   203 DCKQPKLAKRPYRPR--ECECRFPLSLCEAER 232
            :|.:.:|.|    ||  ||.|....|.|:..|
  Fly   200 ECSRSRLRK----PRGVECNCLDVPSSCDLIR 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11635NP_610372.1 DM6 88..235 CDD:214775 51/161 (32%)
CG8701NP_610376.1 DUF1431 81..231 CDD:284625 51/160 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451808
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005300
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20977
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.