DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11635 and swif

DIOPT Version :9

Sequence 1:NP_610372.1 Gene:CG11635 / 35808 FlyBaseID:FBgn0033283 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001097231.1 Gene:swif / 246569 FlyBaseID:FBgn0050366 Length:284 Species:Drosophila melanogaster


Alignment Length:289 Identity:80/289 - (27%)
Similarity:110/289 - (38%) Gaps:84/289 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RGFSSRQSGSSNKPPKPPSPPKPPSSPSPP------------------------------KSPSA 42
            |.|:::..|..:...|......||..|..|                              :....
  Fly    14 RSFATKAQGFRSFASKVTYHADPPCQPVDPLCHHVPSGRCVQARETINLKLPHERLLKQERDQKK 78

  Fly    43 KRECKI-----RTHCI----PAAFCAEGDKFKSMWDPPKNLPPPYPFVVSRSNDLCCEPNCTKPL 98
            :|:|.:     :..|:    |.|...|...|:|||:||           .::|:   :|.|.:.|
  Fly    79 ERKCCVLRSAAKNPCVEIRRPKAAKLEEKPFRSMWEPP-----------CKANE---QPFCKEML 129

  Fly    99 PSFDELYYRPSCKNGPYQRHWVECPKFMIRKKIICAYDKLEALSPARRV---------AERRERT 154
            |.||.:||.||.|...|||.||||.....|.|.:|..|.:|......|:         ...:.|.
  Fly   130 PRFDAMYYHPSNKCRCYQRTWVECSPVKKRLKKVCCLDAIEPPEILYRIRPPCPGTCQINYKARR 194

  Fly   155 TLSATA------TGPCPHF----APLARCVPGRRPPRCHAAKTPSCCRRLCAPMPCWSDCKQPKL 209
            .|.|..      |..||.|    ..||||     .|||...:.|:.|.:|.||.||:|:    |:
  Fly   195 LLCADGEWERDPTRKCPKFFHPCCKLARC-----NPRCSRGRKPTLCTKLRAPYPCYSE----KI 250

  Fly   210 -AKRPYRPRECEC--RFPLSLCEAERGRQ 235
             ..||.|.|||.|  ..|..:..|||.|:
  Fly   251 RGTRPLRKRECLCLETTPKCIALAERMRR 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11635NP_610372.1 DM6 88..235 CDD:214775 58/168 (35%)
swifNP_001097231.1 DUF1431 121..278 CDD:284625 58/168 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451807
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005300
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20977
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.