DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11635 and cola

DIOPT Version :9

Sequence 1:NP_610372.1 Gene:CG11635 / 35808 FlyBaseID:FBgn0033283 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_724673.1 Gene:cola / 246566 FlyBaseID:FBgn0050363 Length:259 Species:Drosophila melanogaster


Alignment Length:246 Identity:70/246 - (28%)
Similarity:95/246 - (38%) Gaps:63/246 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 CKIRTHCIPAAFCAEGDKFKSM-WDPPKNLPPPYPFVVSRSNDLCCE--------PNCTKPLPSF 101
            ||:|.....|  |.:|..|..: ::|.|....| .|.|...:....|        |:|...|...
  Fly    36 CKMRDKDTTA--CKDGKWFCPVKYEPNKCYEKP-SFAVEEYSQYLQEIYNRGKTNPDCLLKLIRH 97

  Fly   102 DELYYRPSCKNGPYQRHWVECPKFMIRKKIICAYDKLEALSPARRVAERRERTTLSA-------- 158
            |..:|:||.|...:||.|.|||...:|.|..|..|: |...|..|.....:...|||        
  Fly    98 DAEHYKPSDKQRKFQRTWPECPLLWLRPKDYCCPDQ-EVYQPMNRRIRPPQEPPLSAIEKHLFQM 161

  Fly   159 -----TATGPCPHFAPLARCVPGRRPPRCHAAKTPS-CCRRLCAPMPCWSDCKQPKLAKRPYRPR 217
                 :...||        |..|||||:|...:.|| ||::. .|||.:|:      |.|...||
  Fly   162 SIFCKSVRAPC--------CKVGRRPPKCTKPRRPSECCKKF-TPMPSFSE------ACRHLIPR 211

  Fly   218 ----ECECRFPLSLCEAERGRQWVKIHGENHVCPSAIKKAKKARKDMLKKM 264
                ||.||.. ||||     .|           :......|:|::..|.:
  Fly   212 FCGSECACRGG-SLCE-----MW-----------NTYNMCNKSRRNCTKPL 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11635NP_610372.1 DM6 88..235 CDD:214775 54/172 (31%)
colaNP_724673.1 DM6 84..232 CDD:214775 54/180 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451810
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005300
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20977
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.