DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30371 and C1R

DIOPT Version :9

Sequence 1:NP_610370.1 Gene:CG30371 / 35806 FlyBaseID:FBgn0050371 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001341275.1 Gene:C1R / 715 HGNCID:1246 Length:719 Species:Homo sapiens


Alignment Length:401 Identity:98/401 - (24%)
Similarity:153/401 - (38%) Gaps:95/401 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DNTFNLSPGTTYVESPYYPNNYPGGTSCRYKFTAPLDYY---IQVQC------------SLGIPK 74
            |.|::.:.....::....|.|.|.| ..||..|..::.|   ||..|            |....:
Human   375 DGTWHRAMPRCKIKDCGQPRNLPNG-DFRYTTTMGVNTYKARIQYYCHEPYYKMQTRAGSRESEQ 438

  Fly    75 GNGQCTTDNFWL-DTEGDLLMRGAENFCGSGTLSRESLFTELVFAYISTGTKGGSFKCTLTTVKQ 138
            |...||....|. :.:|:.:.| ....||.                            .:..|:|
Human   439 GVYTCTAQGIWKNEQKGEKIPR-CLPVCGK----------------------------PVNPVEQ 474

  Fly   139 NCNCGWSATTRIANGQQAAANEFPSMAALKDVTKNQASFCGGTIVAHRYILTAAHCIY-----QV 198
            .        .||..||:|....||     ..|..|.....||.::..|:||||||.:|     ..
Human   475 R--------QRIIGGQKAKMGNFP-----WQVFTNIHGRGGGALLGDRWILTAAHTLYPKEHEAQ 526

  Fly   199 SRATNIVAIVGTN-----DLGNPSSSRYYQQYNIQQMIPHEQYVSDPDVN--NDIAVLITASNIQ 256
            |.|:..|.:..||     .|||         :.|:::..|..|..|...|  .|||:|...:::.
Human   527 SNASLDVFLGHTNVEELMKLGN---------HPIRRVSVHPDYRQDESYNFEGDIALLELENSVT 582

  Fly   257 WSRGVGPICLPPVGTSTPFTYDLVDVIGYGTVF--FAGPTSTSLQKINLNVVTNQDCQT--EYNN 317
            ....:.|||||...|    .||| .::||.:.|  .....:..|:.:.|.|...|.|:.  ...|
Human   583 LGPNLLPICLPDNDT----FYDL-GLMGYVSGFGVMEEKIAHDLRFVRLPVANPQACENWLRGKN 642

  Fly   318 VATIYTGQMCTYDYSGTGRDSCQFDSGGPVILR---KSRQFLVGIISYGKSCAESQYPMGVNTRI 379
            ...:::..|....:....:|:||.||||...:|   ..|....||:|:|..|:..   .|..|::
Human   643 RMDVFSQNMFCAGHPSLKQDACQGDSGGVFAVRDPNTDRWVATGIVSWGIGCSRG---YGFYTKV 704

  Fly   380 TSYISWIRQKI 390
            .:|:.||::::
Human   705 LNYVDWIKKEM 715

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30371NP_610370.1 CUB 24..>67 CDD:294042 12/44 (27%)
Tryp_SPc 149..386 CDD:214473 72/255 (28%)
Tryp_SPc 150..389 CDD:238113 73/257 (28%)
C1RNP_001341275.1 CUB 41..152 CDD:214483
FXa_inhibition 175..203 CDD:317114
CUB 207..316 CDD:278839
Sushi 323..385 CDD:306569 2/9 (22%)
Sushi 390..461 CDD:306569 18/72 (25%)
Tryp_SPc 477..711 CDD:214473 72/255 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.