DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30371 and f9b

DIOPT Version :9

Sequence 1:NP_610370.1 Gene:CG30371 / 35806 FlyBaseID:FBgn0050371 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001035400.1 Gene:f9b / 678552 ZFINID:ZDB-GENE-060421-7346 Length:507 Species:Danio rerio


Alignment Length:280 Identity:88/280 - (31%)
Similarity:137/280 - (48%) Gaps:32/280 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 STGTKGGSFK-CTLTTVKQNCNCGWSATTRIANGQQAAANEFP-SMAALKDVTKNQASFCGGTIV 183
            ||.|...|.: .:.:.:..|.|...:...||..|.:|...|.| .:..|:.|  |:..||||:::
Zfish   226 STSTPRNSLQNVSSSPILTNINNTTNNKYRIVGGDEAIPGEIPWQVVFLEKV--NKIVFCGGSLL 288

  Fly   184 AHRYILTAAHCIYQVSRATNIVAIVGTNDLG---NPSSSRYYQQYNIQQMIPHEQYVSDPDV-NN 244
            :..:::|||||:  ..:..:....||.:|:.   ...|....::|:|     |.:|.|...: |:
Zfish   289 SEEWVITAAHCV--EGKQGSFFIRVGEHDVSKMEGTESDHGIEEYHI-----HPRYNSQRSLYNH 346

  Fly   245 DIAVLITASNIQWSRGVGPICLPPVGTSTPFTYDLVD------VIGYGTVFFAGPTSTSLQKINL 303
            |||:|.....:.......||||    .|..||.:|:.      |.|:|.:.:.|..|..|||:.|
Zfish   347 DIALLKLKKPVILFDYAVPICL----GSKDFTENLLQSAENSLVSGWGRLRYGGIESNVLQKVEL 407

  Fly   304 NVVTNQDCQTEYNNVATIYTGQMCTYDYSGTGRDSCQFDSGGPVILR-KSRQFLVGIISYGKSCA 367
            ..|....|:.  ::..:|.....|. .||...:|:||.|||||...| |...||.||:|:|:.||
Zfish   408 PYVDRIKCKG--SSTDSISRFMFCA-GYSTVRKDACQGDSGGPHATRYKDTWFLTGIVSWGEECA 469

  Fly   368 -ESQYPMGVNTRITSYISWI 386
             |.:|  |:.|||:.|::||
Zfish   470 KEGKY--GIYTRISKYMAWI 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30371NP_610370.1 CUB 24..>67 CDD:294042
Tryp_SPc 149..386 CDD:214473 80/249 (32%)
Tryp_SPc 150..389 CDD:238113 81/250 (32%)
f9bNP_001035400.1 GLA 23..86 CDD:214503
EGF_CA 88..124 CDD:238011
FXa_inhibition 131..167 CDD:291342
Tryp_SPc 255..487 CDD:214473 80/249 (32%)
Tryp_SPc 256..490 CDD:238113 81/250 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.