DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30371 and Masp1

DIOPT Version :9

Sequence 1:NP_610370.1 Gene:CG30371 / 35806 FlyBaseID:FBgn0050371 Length:399 Species:Drosophila melanogaster
Sequence 2:XP_006248588.1 Gene:Masp1 / 64023 RGDID:620213 Length:733 Species:Rattus norvegicus


Alignment Length:559 Identity:115/559 - (20%)
Similarity:190/559 - (33%) Gaps:207/559 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 NTFNLSPGTTYVESPYYPNNYPGGTSCRY------------------------KFTAPLDYY--- 63
            |.|....||  :.||.|||.||..:.|.|                        :...|.||.   
  Rat   193 NLFTQRTGT--ITSPDYPNPYPKSSECSYTIDLEEGFMVTLQFEDIFDIEDHPEVPCPYDYIKIK 255

  Fly    64 ------------------------IQV----------------------QCSLGIPKGNGQ---- 78
                                    ||:                      :|....|...|:    
  Rat   256 AGSKVWGPFCGEKSPEPISTQSHSIQILFRSDNSGENRGWRLSYRAAGNECPKLQPPVYGKIEPS 320

  Fly    79 -------------CTT------DNFWLDT-EGDLLMRGAEN---------FCGSGTLSRESLFTE 114
                         |.|      ||..:|| :.:.|..||.:         .||...:.:..|.| 
  Rat   321 QAVYSFKDQVLISCDTGYKVLKDNEVMDTFQIECLKDGAWSNKIPTCKIVDCGVPAVLKHGLVT- 384

  Fly   115 LVFAYISTGTKGGSFKCTL--------------TTVKQNCN--------------------CGW- 144
                 .||.....::|..:              ||....|:                    ||. 
  Rat   385 -----FSTRNNLTTYKSEIRYSCQQPYYKMLHNTTGVYTCSAHGTWTNEVLKRSLPTCLPVCGQP 444

  Fly   145 -----SATTRIANGQQAAANEFP--SMAALKDVTK--NQASFCGGTIVAHRYILTAAHCIYQVSR 200
                 :...||..|:.|....||  ::..::|.::  |...|..|.:::..:||||||.:....|
  Rat   445 SRALPNLVKRIIGGRNAELGLFPWQALIVVEDTSRIPNDKWFGSGALLSESWILTAAHVLRSQRR 509

  Fly   201 ATNIVAI--------VGTNDLG------NPSSSR--YYQQYNIQQMIPHEQYVSDPDVNNDIAVL 249
            ...::.:        :|.:|:.      |.|::|  .:..:|||            :.|:|||::
  Rat   510 DNTVIPVSKDHVTVYLGLHDVRDKSGAVNSSAARVVLHPDFNIQ------------NYNHDIALV 562

  Fly   250 ITASNIQWSRGVGPICLPPVGTSTPFTYDLVDVIGYG---------TVFFAGPTSTS--LQKINL 303
            .....:.....|.|||||......|..:.|..|.|:|         .:..:|..:.|  ||.:.|
  Rat   563 QLQEPVPLGAHVMPICLPRPEPEGPAPHMLGLVAGWGISNPNVTVDEIIISGTRTLSDVLQYVKL 627

  Fly   304 NVVTNQDCQTEYNNVATIYT---GQMCTYDYSGTGRDSCQFDSGGPVIL---RKSRQFLVGIISY 362
            .||::.:|:..|.:.:..|:   ...|...|.| |:|:|..||||..::   ...|....|::|:
  Rat   628 PVVSHAECKASYESRSGNYSVTENMFCAGYYEG-GKDTCLGDSGGAFVIFDEMSQRWVAQGLVSW 691

  Fly   363 G--KSCAESQYPMGVNTRITSYISWIRQKIGNSNCVVSL 399
            |  :.|...|. .||.|::::|:.|:.:::.:...|..|
  Rat   692 GGPEECGSKQV-YGVYTKVSNYVDWLLEEMNSPRGVREL 729

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30371NP_610370.1 CUB 24..>67 CDD:294042 18/113 (16%)
Tryp_SPc 149..386 CDD:214473 70/275 (25%)
Tryp_SPc 150..389 CDD:238113 70/277 (25%)
Masp1XP_006248588.1 CUB 33..142 CDD:238001
FXa_inhibition 158..186 CDD:291342
CUB 190..299 CDD:278839 18/107 (17%)
CCP 306..368 CDD:153056 12/61 (20%)
CCP 372..437 CDD:153056 10/70 (14%)
Tryp_SPc 454..715 CDD:214473 70/274 (26%)
Tryp_SPc 455..716 CDD:238113 69/274 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.