DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30371 and CG34290

DIOPT Version :9

Sequence 1:NP_610370.1 Gene:CG30371 / 35806 FlyBaseID:FBgn0050371 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001097899.2 Gene:CG34290 / 5740609 FlyBaseID:FBgn0085319 Length:282 Species:Drosophila melanogaster


Alignment Length:268 Identity:74/268 - (27%)
Similarity:130/268 - (48%) Gaps:25/268 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 LTTVKQNCNCGWSATTRIANGQQAAANEFPSMAALKDV-TKNQAS------FCGGTIVAHRYILT 190
            :.:|.::|:.......||.:...::.:::|.|.:|:|| |:|..:      ||||::::.|:||:
  Fly    22 IISVLESCHAVPIVGGRIVSTVGSSTSKYPFMVSLQDVITRNTTNGVSYQHFCGGSLISDRWILS 86

  Fly   191 AAHCIYQVSRATNIVAIVGTNDLGNPSSSRYYQQYNIQQMIPHEQYVSDPDVNNDIAVLITASNI 255
            ||||::: .....|.|.:|..::.|....:.|...:::.:     |....:..||||:|..... 
  Fly    87 AAHCVWR-KNIHYIAAFIGYENIENIGQLQPYGLESVEYI-----YFQPSNFRNDIALLYMKRR- 144

  Fly   256 QWS---RGVGPICLPPVGTSTPFTYDLVDVIGYGTVFFAGPTSTSLQKINLNVVTNQDCQTEYNN 317
            .||   .|:....|||.|.. |...:...:||||....|||....|.:..:.|:.||.|:....:
  Fly   145 YWSDFGNGLQYAQLPPHGMK-PDQNESCRIIGYGATHHAGPCQKRLFEAEVRVIDNQKCRDIIGH 208

  Fly   318 VATIYTG--QMCTYDYSGTGRDSCQFDSGGPVILR-KSRQFLVGIISYGKSCAESQYPMGVNTRI 379
            :.....|  .:|..   |..:||||.|||||:|.. ..:.::.|::|:|.:|.....| .:.|..
  Fly   209 IWAPQNGANTVCAL---GNNQDSCQGDSGGPLICTYGGKDYIYGLVSHGLTCGIPGMP-SIYTVT 269

  Fly   380 TSYISWIR 387
            ..|..|::
  Fly   270 RPYYDWVQ 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30371NP_610370.1 CUB 24..>67 CDD:294042
Tryp_SPc 149..386 CDD:214473 71/249 (29%)
Tryp_SPc 150..389 CDD:238113 71/251 (28%)
CG34290NP_001097899.2 Tryp_SPc 34..277 CDD:238113 72/254 (28%)
Tryp_SPc 34..276 CDD:214473 71/253 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456024
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.