DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30371 and CG34437

DIOPT Version :9

Sequence 1:NP_610370.1 Gene:CG30371 / 35806 FlyBaseID:FBgn0050371 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster


Alignment Length:244 Identity:59/244 - (24%)
Similarity:109/244 - (44%) Gaps:47/244 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 QAAANEFPSMAALKDVTKNQASFCGGTIVAHRYILTAAHCIYQVSRATNIVAIVGTNDLGNPSSS 219
            |....|.|.||.:...|||    |.||::..:|::|.|.|::..|.:|   ..:|..| ..|.:.
  Fly    34 QDVFKETPWMAFIASPTKN----CSGTLINKQYVITTASCVFDQSEST---VFLGRFD-NIPQNR 90

  Fly   220 RYYQQYNIQQMIPHEQYVSDPDVNNDIAVLITASNIQWSRGVGPICLPPVGTSTPFTYDLVDVIG 284
            ..|.::::|.:..|:.| :.....:|||:|:....:.:...:.|||: .:|..|...:  ::...
  Fly    91 NRYVKHSVQSVYTHKLY-NKQTFEHDIALLLLDDPVTFKMSIQPICI-WLGEITNLNH--LESNR 151

  Fly   285 YG----TVFFAGPTSTSLQKIN-LNVVTNQDCQTEYNNVATIYTGQMCTYDYSGTGRDSCQFDSG 344
            :|    .:|         |:|| :.::..:.|:..:.  .|:...|:|....:|   :.|. ::|
  Fly   152 WGLSEKMIF---------QRINTVKILKIKKCRDSFG--ITLKKSQICAGFQNG---NICT-ETG 201

  Fly   345 GPVILR-----KSRQFLVGIISYGKS--CAESQYPMGVNTRITSYISWI 386
            ..::.:     |....|:||.|||.|  |        :..:|..||.||
  Fly   202 SSLVKQIHYSGKLWNTLIGIQSYGVSERC--------IYNKIAHYIDWI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30371NP_610370.1 CUB 24..>67 CDD:294042
Tryp_SPc 149..386 CDD:214473 57/242 (24%)
Tryp_SPc 150..389 CDD:238113 59/244 (24%)
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 56/237 (24%)
Tryp_SPc 39..242 CDD:304450 56/237 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455905
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.