DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30371 and MASP1

DIOPT Version :9

Sequence 1:NP_610370.1 Gene:CG30371 / 35806 FlyBaseID:FBgn0050371 Length:399 Species:Drosophila melanogaster
Sequence 2:XP_011511291.1 Gene:MASP1 / 5648 HGNCID:6901 Length:735 Species:Homo sapiens


Alignment Length:559 Identity:121/559 - (21%)
Similarity:197/559 - (35%) Gaps:203/559 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 EGCDNTFNLSPGTTYVESPYYPNNYPGGTSCRY------------------------KFTAPLDY 62
            |..||.|....|.  :.||.:||.||..:.|.|                        :...|.||
Human   191 ECSDNLFTQRTGV--ITSPDFPNPYPKSSECLYTIELEEGFMVNLQFEDIFDIEDHPEVPCPYDY 253

  Fly    63 YIQVQCSLGIPKGNGQ-C--------TTDN------FWLDTEGD-----LLMRGAENFCGS---- 103
               ::..:| ||..|. |        :|.:      |..|..|:     |..|.|.|.|..    
Human   254 ---IKIKVG-PKVLGPFCGEKAPEPISTQSHSVLILFHSDNSGENRGWRLSYRAAGNECPELQPP 314

  Fly   104 --GTL---SRESLFTELVFAYISTG-----------------TKGGSFK----------C----- 131
              |.:   ..:..|.:.|.....||                 .|.|::.          |     
Human   315 VHGKIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDTFQIECLKDGTWSNKIPTCKIVDCRAPGE 379

  Fly   132 ------------TLTT----VKQNC-------------------------------------NCG 143
                        .|||    :|.:|                                     .||
Human   380 LEHGLITFSTRNNLTTYKSEIKYSCQEPYYKMLNNNTGIYTCSAQGVWMNKVLGRSLPTCLPECG 444

  Fly   144 W------SATTRIANGQQAAANEFP--SMAALKDVTK--NQASFCGGTIVAHRYILTAAHCIYQV 198
            .      |...||..|:.|....||  ::..::|.::  |...|..|.:::..:||||||.:...
Human   445 QPSRSLPSLVKRIIGGRNAEPGLFPWQALIVVEDTSRVPNDKWFGSGALLSASWILTAAHVLRSQ 509

  Fly   199 SRATNIVAI--------VGTNDLG------NPSSSR--YYQQYNIQQMIPHEQYVSDPDVNNDIA 247
            .|.|.::.:        :|.:|:.      |.|::|  .:..:|||            :.|:|||
Human   510 RRDTTVIPVSKEHVTVYLGLHDVRDKSGAVNSSAARVVLHPDFNIQ------------NYNHDIA 562

  Fly   248 VLITASNIQWSRGVGPICLPPVGTSTPFTYDLVDVIGYG---------TVFFAGPTSTS--LQKI 301
            ::.....:.....|.|:|||.:....|..:.|..|.|:|         .:..:|..:.|  ||.:
Human   563 LVQLQEPVPLGPHVMPVCLPRLEPEGPAPHMLGLVAGWGISNPNVTVDEIISSGTRTLSDVLQYV 627

  Fly   302 NLNVVTNQDCQTEYNNVATIYT---GQMCTYDYSGTGRDSCQFDSGGPVIL---RKSRQFLVGII 360
            .|.||.:.:|:|.|.:.:..|:   ...|...|.| |:|:|..||||..::   ...|..:.|::
Human   628 KLPVVPHAECKTSYESRSGNYSVTENMFCAGYYEG-GKDTCLGDSGGAFVIFDDLSQRWVVQGLV 691

  Fly   361 SYG--KSCAESQYPMGVNTRITSYISWIRQKIGNSNCVV 397
            |:|  :.|...|. .||.|::::|:.|:.:::|....||
Human   692 SWGGPEECGSKQV-YGVYTKVSNYVDWVWEQMGLPQSVV 729

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30371NP_610370.1 CUB 24..>67 CDD:294042 15/66 (23%)
Tryp_SPc 149..386 CDD:214473 71/275 (26%)
Tryp_SPc 150..389 CDD:238113 71/277 (26%)
MASP1XP_011511291.1 CUB 35..144 CDD:238001
FXa_inhibition 160..188 CDD:291342
CUB 192..301 CDD:278839 25/114 (22%)
Sushi 308..369 CDD:278512 8/60 (13%)
CCP 374..439 CDD:153056 6/64 (9%)
Tryp_SPc 456..718 CDD:214473 71/275 (26%)
Tryp_SPc 457..718 CDD:238113 70/274 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.