DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30371 and C1RL

DIOPT Version :9

Sequence 1:NP_610370.1 Gene:CG30371 / 35806 FlyBaseID:FBgn0050371 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_057630.2 Gene:C1RL / 51279 HGNCID:21265 Length:487 Species:Homo sapiens


Alignment Length:371 Identity:85/371 - (22%)
Similarity:132/371 - (35%) Gaps:86/371 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 NYPGGTSCRYKFTAPLDYYIQVQCSLGIPKGNGQCTTDNFWLDTEGDLLMRGAENFCGSGTLSRE 109
            |.||....:.:......||   |.:..   |...|.|...|.|.:....:......||.      
Human   182 NAPGDNPAKVQNHCQEPYY---QAAAA---GALTCATPGTWKDRQDGEEVLQCMPVCGR------ 234

  Fly   110 SLFTELVFAYISTGTKGGSFKCTLTTVKQNCNCGWSATTRIANGQQAAANEFPSMAALKDVTKNQ 174
                                  .:|.:.||.....|:..::.|        ||..|......:. 
Human   235 ----------------------PVTPIAQNQTTLGSSRAKLGN--------FPWQAFTSIHGRG- 268

  Fly   175 ASFCGGTIVAHRYILTAAHCIY-------QVSRATNI----VAIVGTNDLGNPSSSRYYQQYNIQ 228
                ||.::..|:||||||.||       :.:::.|:    .||.....|||         :.:.
Human   269 ----GGALLGDRWILTAAHTIYPKDSVSLRKNQSVNVFLGHTAIDEMLKLGN---------HPVH 320

  Fly   229 QMIPHEQYVSDPDVN--NDIAVLITASNIQWSRGVGPICLPPVGTSTPFTYDLVD-VIGYGTVFF 290
            :::.|..|..:...|  .|||:|....:|.....|.|:|||  ...|.:...|:. |.|:|... 
Human   321 RVVVHPDYRQNESHNFSGDIALLELQHSIPLGPNVLPVCLP--DNETLYRSGLLGYVSGFGMEM- 382

  Fly   291 AGPTSTSLQKINLNVVTNQDCQT--EYNNVATIYTGQM-CTYDYSGTGRDS-CQFDSGGPVIL-- 349
             |..:|.|:...|.|...:.|..  :......:::..| |..|  .|.|.| ||.|||...::  
Human   383 -GWLTTELKYSRLPVAPREACNAWLQKRQRPEVFSDNMFCVGD--ETQRHSVCQGDSGSVYVVWD 444

  Fly   350 -RKSRQFLVGIISYGKSCAESQYPMGVNTRITSYISWIRQKIGNSN 394
             ........||:|:|..|.|.   ....|::.||:.||:..:...|
Human   445 NHAHHWVATGIVSWGIGCGEG---YDFYTKVLSYVDWIKGVMNGKN 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30371NP_610370.1 CUB 24..>67 CDD:294042 5/21 (24%)
Tryp_SPc 149..386 CDD:214473 65/257 (25%)
Tryp_SPc 150..389 CDD:238113 67/259 (26%)
C1RLNP_057630.2 CUB 40..162 CDD:238001
Tryp_SPc 247..480 CDD:238113 67/263 (25%)
Tryp_SPc 247..479 CDD:214473 66/262 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.