DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30371 and CG11670

DIOPT Version :9

Sequence 1:NP_610370.1 Gene:CG30371 / 35806 FlyBaseID:FBgn0050371 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001368950.1 Gene:CG11670 / 41608 FlyBaseID:FBgn0038114 Length:431 Species:Drosophila melanogaster


Alignment Length:289 Identity:86/289 - (29%)
Similarity:149/289 - (51%) Gaps:38/289 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 YISTGTK--GGSFKCTLTTVKQNCNCGWSATTRIANGQQAAANEFPSMAALKDVTKN-QASF-CG 179
            :::|.:|  |.::..|..|  ::.:..::..:.:|.||      :|.||||....:| :..: ||
  Fly   145 FLNTESKVDGENYNKTAET--EDLHDDFNGRSIVAPGQ------YPHMAALGFRNENHEIDYKCG 201

  Fly   180 GTIVAHRYILTAAHCIYQVSRATNIVAIVGTNDLGNPSSSRYYQQYNIQQMIPHEQYVSDPDVN- 243
            |::::..::||||||:.....:.:||.| |...|.....:...|:..:.|:..|..|  :..:| 
  Fly   202 GSLISEEFVLTAAHCLTTHGTSPDIVKI-GDIKLKEWELNVAPQRRRVAQIYLHPLY--NASLNY 263

  Fly   244 NDIAVLITASNIQWSRGVGPICLPPVGTSTPFTYDLVDVIGYGTVFFAGPTSTSLQKINLNVVTN 308
            :||.::.....::::..|.|:.|.|:   ....|..:..:|||:..||.|.:..|.:::|:||..
  Fly   264 HDIGLIQLNRPVEYTWFVRPVRLWPM---NDIPYGKLHTMGYGSTGFAQPQTNILTELDLSVVPI 325

  Fly   309 QDCQT----EYNNVATIYTGQMCTYDYSGTGRDSCQFDSGGPVILRKSRQ------------FLV 357
            :.|.:    :..:...:.|.|:|.:||. ..||:||.|||||:.|...|:            :||
  Fly   326 EQCNSSLPADEGSPHGLLTSQICAHDYE-KNRDTCQGDSGGPLQLNLERRRRRHTSRKHYRYYLV 389

  Fly   358 GIISYGKSCAESQYPMGVNTRITSYISWI 386
            ||.|||..| .|:.| ||.||::|||.||
  Fly   390 GITSYGAYC-RSELP-GVYTRVSSYIDWI 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30371NP_610370.1 CUB 24..>67 CDD:294042
Tryp_SPc 149..386 CDD:214473 79/255 (31%)
Tryp_SPc 150..389 CDD:238113 81/256 (32%)
CG11670NP_001368950.1 Tryp_SPc 172..419 CDD:238113 81/260 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455975
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.