DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30371 and CG11668

DIOPT Version :9

Sequence 1:NP_610370.1 Gene:CG30371 / 35806 FlyBaseID:FBgn0050371 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_650254.1 Gene:CG11668 / 41606 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster


Alignment Length:271 Identity:87/271 - (32%)
Similarity:131/271 - (48%) Gaps:52/271 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 IANGQQAAANEFPSMAAL------------KDVTKNQASF-CGGTIVAHRYILTAAHCIYQVSRA 201
            :..|:....||.|.|.||            ...:|.:.:| ||..::|.|:.:|||||. .|...
  Fly   148 LVGGRLTQENEHPYMCALGWPSRTNRWIHEHGSSKRRYTFNCGCAMIAPRFAITAAHCA-SVGGE 211

  Fly   202 TNIVAIVGTNDLGNPSSSRYYQQYNIQQMIPHEQYVSDPDVNNDIAVLITASNIQ------WSRG 260
            :..||::|..:|    :|...|...|:::..|..:.:: .:.||:||:..|....      |::.
  Fly   212 SPSVALIGGVEL----NSGRGQLIEIKRISQHPHFDAE-TLTNDLAVVKLARRSHMPVACLWNQE 271

  Fly   261 VGPICLPPVGTSTPFTYDLVDVIGYGTVFFAGPTSTSLQKINLNVVTNQDCQT---EYNNVAT-I 321
            ..|        ..|.|     .:|||...||||.|::|.:|.|..:..|.||.   .|:.:|. :
  Fly   272 SLP--------ERPLT-----ALGYGQTKFAGPHSSNLLQIMLYHLNFQQCQRYLHNYDKLANGL 323

  Fly   322 YTGQMCTYDYSGTGRDSCQFDSGGPVIL-------RKSRQFLVGIISYGKSCAESQYPMGVNTRI 379
            .:||||..|||| ..|:||.|||||::|       |.:..::|||.|:|.:||..|  .||..||
  Fly   324 GSGQMCAGDYSG-NMDTCQGDSGGPLLLHQHMRHHRHTIPYVVGITSFGGACASGQ--PGVYVRI 385

  Fly   380 TSYISWIRQKI 390
            ..||.||.|::
  Fly   386 AHYIQWIEQQV 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30371NP_610370.1 CUB 24..>67 CDD:294042
Tryp_SPc 149..386 CDD:214473 84/265 (32%)
Tryp_SPc 150..389 CDD:238113 86/268 (32%)
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 86/267 (32%)
Tryp_SPc 149..392 CDD:214473 84/264 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455973
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.