DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30371 and CG10041

DIOPT Version :9

Sequence 1:NP_610370.1 Gene:CG30371 / 35806 FlyBaseID:FBgn0050371 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_650177.2 Gene:CG10041 / 41496 FlyBaseID:FBgn0038014 Length:287 Species:Drosophila melanogaster


Alignment Length:303 Identity:67/303 - (22%)
Similarity:106/303 - (34%) Gaps:96/303 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 CNCGWSATTRIANG--QQAAANEFPSMAALKDVTK----------------NQASF----CGGTI 182
            |:..|.|....|..  .....|..|.:|.....||                |...:    |.|.|
  Fly     8 CSIAWFAAMSAAQETLSDTPQNSTPLLATTVSTTKVISFRPRYPYIVSIGENLKGYYKHLCVGVI 72

  Fly   183 VAHRYILTAAHCIYQVSRATNIVAIVGTNDLGNPSSSRYYQQYNIQQMIPHEQYVSDPDV--NND 245
            :::.::|:||||| |.:....:....|.:.|.:...:|::    :.:...|.|:    .|  .||
  Fly    73 LSNEFVLSAAHCI-QTNPTKQLYVAGGADSLNSRKQTRFF----VVERRWHPQF----RVLGGND 128

  Fly   246 IAVL---------------------------ITASNIQWSR-GVGPICLPPVGTSTPFTYDLVDV 282
            ||||                           ..||.:.|.| |||.|                  
  Fly   129 IAVLRIYPKFPLDDVRFRSINFAGKPQRDSGTQASLVGWGRVGVGKI------------------ 175

  Fly   283 IGYGTVFFAGPTSTSLQKINLNVVTNQDCQTEYNNVATIYTGQMCTYDYSGTGRDSCQFDSGGPV 347
                         ..||::....:.|.:||..:..| .:....:|.....|. |..|..|||.| 
  Fly   176 -------------RKLQEMPFLTMENDECQQSHRFV-FLKPLDICAMHLKGP-RGPCDGDSGAP- 224

  Fly   348 ILRKSRQFLVGIISYGKSCAESQYPMGVNTRITSYISWIRQKI 390
            ::..:::.|.|::|||:.......|... |||.:|.|||::.:
  Fly   225 LMNVAKEKLYGLLSYGRKACTPLKPYAF-TRINAYSSWIQESM 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30371NP_610370.1 CUB 24..>67 CDD:294042
Tryp_SPc 149..386 CDD:214473 62/288 (22%)
Tryp_SPc 150..389 CDD:238113 64/290 (22%)
CG10041NP_650177.2 Tryp_SPc 49..264 CDD:238113 58/258 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456013
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.