DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30371 and CG16749

DIOPT Version :9

Sequence 1:NP_610370.1 Gene:CG30371 / 35806 FlyBaseID:FBgn0050371 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster


Alignment Length:294 Identity:76/294 - (25%)
Similarity:142/294 - (48%) Gaps:46/294 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 LSRESLFTELVFAYISTGTKGGSFKCTLTTVKQNCNCGWSATTRIANGQQAAANEFPSMAALKDV 170
            :||.......|||.::|.               ..:.|.....|:.||..::..::|.:.:::..
  Fly     1 MSRNQDLCLAVFALLTTA---------------GISHGAPQMGRVVNGTDSSVEKYPFVISMRGS 50

  Fly   171 TKNQASFCGGTIVAHRYILTAAHCIYQVSRATNIVAIVGTNDLG--NPSSSRYYQQYNIQQMIPH 233
            :.:.:  |||:|::.::::|||||. ...:|:::....|...:.  .|:..|      ::::|.|
  Fly    51 SGSHS--CGGSIISKQFVMTAAHCT-DGRKASDLSVQYGVTKINATGPNVVR------VKKIIQH 106

  Fly   234 EQYVSDPDVNNDIAVLITASNIQWSR-GVGPICLPPVGTSTPFTYDLVD------VIGYGTVFFA 291
            |.|....:..|||::|:.....::.. .|.|:.||.:..:||.|    |      :||:|.....
  Fly   107 EDYNPYNNYANDISLLLVEEPFEFDGVTVAPVKLPELAFATPQT----DAGGEGVLIGWGLNATG 167

  Fly   292 GPTSTSLQKINLNVVTNQDCQTEYNNVATIYTGQMC-TYDYSGTGRDSCQFDSGGPVILRKSRQF 355
            |...::||::.|.|.::::| ||.:...|.....:| ..|..|.|:  |..|||||:|....:  
  Fly   168 GYIQSTLQEVELKVYSDEEC-TERHGGRTDPRYHICGGVDEGGKGQ--CSGDSGGPLIYNGQQ-- 227

  Fly   356 LVGIISYG-KSCAESQYPMGVNTRITSYISWIRQ 388
             |||:|:. |.|..:.|| ||..:::.|:.||::
  Fly   228 -VGIVSWSIKPCTVAPYP-GVYCKVSQYVDWIKK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30371NP_610370.1 CUB 24..>67 CDD:294042
Tryp_SPc 149..386 CDD:214473 67/247 (27%)
Tryp_SPc 150..389 CDD:238113 68/250 (27%)
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 67/247 (27%)
Tryp_SPc 30..259 CDD:238113 68/248 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456011
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.