DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30371 and CG12951

DIOPT Version :9

Sequence 1:NP_610370.1 Gene:CG30371 / 35806 FlyBaseID:FBgn0050371 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster


Alignment Length:284 Identity:73/284 - (25%)
Similarity:138/284 - (48%) Gaps:54/284 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 LTTVKQNCNCGWSATTRIANGQQAAANEFPSMAALKDVTKNQASFCGGTIVAHRYILTAAHC--- 194
            :|||.|..    .:.:|:.||..::..::|.:.:|:....:.:  |||:|::..:::|||||   
  Fly    17 VTTVGQAA----PSISRVVNGTDSSVLKYPFVVSLRSYDGSHS--CGGSIISKHFVMTAAHCTNG 75

  Fly   195 ----IYQVSRATNIVAIVGTNDLGNPSSSRYYQQYNIQQMIPHEQYVSDPDVNNDIAVLITASNI 255
                ...:......::.:|.|.:|            |:::|.||.:.......|||::|:.....
  Fly    76 RPADTLSIQFGVTNISAMGPNVVG------------IKKIIQHEDFDPTRQNANDISLLMVEEPF 128

  Fly   256 QWSR-GVGPICLPPVGTSTPFTYDLVD--VIGYGTVFFAGPTSTSLQKINLNVVTNQDCQTEYNN 317
            ::.. .|.|:.||.:..:.|.:...|:  :||:|.....|....:||:::|.:.::::|.:.:| 
  Fly   129 EFDGVSVAPVELPALAFAVPQSDAGVEGVLIGWGLNDTYGSVQDTLQEVSLKIYSDEECTSRHN- 192

  Fly   318 VATIYTGQ------MC-TYDYSGTGRDSCQFDSGGPVILRKSRQFLVGIISYG-KSCAESQYPMG 374
                  ||      :| ..|..|.|:  |..|||||:|....:   |||:|:. |.|..:.|| |
  Fly   193 ------GQTDPKYHICGGVDEGGKGQ--CSGDSGGPLIYNGQQ---VGIVSWSIKPCTVAPYP-G 245

  Fly   375 VNTRITSYISWIRQKIGNSNCVVS 398
            |..:::.|:.||:     ||.::|
  Fly   246 VYCKVSQYVDWIK-----SNQIIS 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30371NP_610370.1 CUB 24..>67 CDD:294042
Tryp_SPc 149..386 CDD:214473 64/254 (25%)
Tryp_SPc 150..389 CDD:238113 65/256 (25%)
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 64/254 (25%)
Tryp_SPc 30..260 CDD:238113 65/261 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456012
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.