DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30371 and C1rl

DIOPT Version :9

Sequence 1:NP_610370.1 Gene:CG30371 / 35806 FlyBaseID:FBgn0050371 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001002804.2 Gene:C1rl / 408246 RGDID:1302936 Length:488 Species:Rattus norvegicus


Alignment Length:413 Identity:91/413 - (22%)
Similarity:142/413 - (34%) Gaps:118/413 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 HLPLISLLLFAPTVLAYFEGCDNTFNLSPGTTYVESPYYPNNYPGGTSCRYKFTAPLDYYIQVQC 68
            ||....|.|:....::...|....|. :||   ...|...|:.||            .||.:.| 
  Rat   153 HLHKGFLALYQAIAVSQPNGDAEAFT-TPG---ANPPEIQNHCPG------------PYYKEEQ- 200

  Fly    69 SLGIPKGNGQCTTDNFWLDTEGDLLMRGAE-----NFCGSGTLSRESLFTELVFAYISTGTKGGS 128
                 .|...|.:...|.|.:     ||.|     ..||...:.    ..|....:.|:..|.|:
  Rat   201 -----TGTLSCPSSRKWKDRQ-----RGEEVPECVPVCGRPVVP----IAENPNTFGSSRAKPGN 251

  Fly   129 FKCTLTTVKQNCNCGWSATTRI-ANGQQAAANEFPSMAALKDVTKNQASFCGGTIVAHRYILTAA 192
            |.             |.|.|.| ..|                         ||.::..|:|||||
  Rat   252 FP-------------WQAFTSIYGRG-------------------------GGALLGDRWILTAA 278

  Fly   193 HCIY-------QVSRATNIVAIVGTND------LGNPSSSRYYQQYNIQQMIPHEQYVSDPDVN- 243
            |.|:       :.::..|:  .:|..|      |||         :.:::::.|..|..:...| 
  Rat   279 HTIFPKDSIYLRKNKTVNV--FLGHTDVDELLKLGN---------HPVRRVVVHPDYRQEESHNF 332

  Fly   244 -NDIAVLITASNIQWSRGVGPICLPPVGT---STPFTYDLVDVIGYGTVFFAGPTSTSLQKINLN 304
             .|||:|.....:.....:.|:|||...|   |..:.|    :.|:|...  |..:|.|:...|.
  Rat   333 DGDIALLELEHRVPLGPSLLPVCLPDNETLYHSGLWGY----ISGFGVEM--GWLTTKLKYSKLP 391

  Fly   305 VVTNQDCQT--EYNNVATIYTGQMCTYDYSGTGRDSCQFDSGGPVIL---RKSRQFLVGIISYGK 364
            |...:.|:.  .......:::..|............||.|||...::   |..|....||:|:|.
  Rat   392 VAPREACEAWLRQRQRTEVFSDNMFCVGEEMQVNSVCQGDSGSVYVVWDDRALRWVATGIVSWGV 456

  Fly   365 SCAESQYPMGVNTRITSYISWIR 387
            .|.:.   .|..|::.||:.||:
  Rat   457 GCGKG---YGFYTKVLSYVDWIK 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30371NP_610370.1 CUB 24..>67 CDD:294042 9/42 (21%)
Tryp_SPc 149..386 CDD:214473 57/260 (22%)
Tryp_SPc 150..389 CDD:238113 59/262 (23%)
C1rlNP_001002804.2 CUB 55..164 CDD:238001 4/10 (40%)
Tryp_SPc 243..476 CDD:238113 65/290 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.