DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30371 and mas

DIOPT Version :9

Sequence 1:NP_610370.1 Gene:CG30371 / 35806 FlyBaseID:FBgn0050371 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_523919.1 Gene:mas / 38499 FlyBaseID:FBgn0011653 Length:1047 Species:Drosophila melanogaster


Alignment Length:250 Identity:70/250 - (28%)
Similarity:117/250 - (46%) Gaps:9/250 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 RIANGQQAAANEFPSMAALKDVTKNQASFCGGTIVAHRYILTAAHCIYQVSRATNIVAI-VGTND 212
            |:..|:.....|:....||  :.......||..::..:::||||||:..:.|:.:.:.: ||..|
  Fly   802 RVVGGEDGENGEWCWQVAL--INSLNQYLCGAALIGTQWVLTAAHCVTNIVRSGDAIYVRVGDYD 864

  Fly   213 LGNPSSSRYYQQYNIQQMIPHEQYVSDPDVNNDIAVLITASNIQWSRGVGPICLPPVGTSTPFTY 277
            |.....|...|...:.....|..:.|. .::||||:|......:...||..:|||..|.|.. ..
  Fly   865 LTRKYGSPGAQTLRVATTYIHHNHNSQ-TLDNDIALLKLHGQAELRDGVCLVCLPARGVSHA-AG 927

  Fly   278 DLVDVIGYGTVFFAGPTSTSLQKINLNVVTNQDCQTEYNNVA-TIYTGQMCTYDYSG-TGRDSCQ 340
            ....|.|||.:..|||....:::..:.:|::.:|..:.|.|. .|:.....::...| .|.|:||
  Fly   928 KRCTVTGYGYMGEAGPIPLRVREAEIPIVSDTECIRKVNAVTEKIFILPASSFCAGGEEGHDACQ 992

  Fly   341 FDSGGPVILRKSRQF-LVGIISYGKSCAESQYPMGVNTRITSYISWIRQKIGNSN 394
            .|.|||::.:....: |.|::|:|..|.....| ||..:.:|:|.||.|.|..:|
  Fly   993 GDGGGPLVCQDDGFYELAGLVSWGFGCGRQDVP-GVYVKTSSFIGWINQIISVNN 1046

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30371NP_610370.1 CUB 24..>67 CDD:294042
Tryp_SPc 149..386 CDD:214473 65/240 (27%)
Tryp_SPc 150..389 CDD:238113 66/242 (27%)
masNP_523919.1 Tryp_SPc 803..1041 CDD:238113 66/242 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455991
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.