DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30371 and CG32277

DIOPT Version :9

Sequence 1:NP_610370.1 Gene:CG30371 / 35806 FlyBaseID:FBgn0050371 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster


Alignment Length:250 Identity:68/250 - (27%)
Similarity:102/250 - (40%) Gaps:81/250 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 CGGTIVAHRYILTAAHCI---YQVSRATNIVAIVGTNDLGNPSSSRYYQQYNIQQMIPHE----- 234
            |||.|::...:||||||:   ||..|...:.|                ||..:...:|.|     
  Fly    52 CGGVIISPNCVLTAAHCLEGRYQQVRDLTVHA----------------QQQCLGDDMPPEHVRSA 100

  Fly   235 -------QYVSDPDVNNDIAVLITASNIQWSR-----GVGPIC------LPPVGTSTPFTYDLVD 281
                   .|.:...:::|:||      |:.||     |...:.      |||....|        
  Fly   101 WYVGLSPNYCAQRGLDSDLAV------IRLSRPFDIAGNASLVKIDYNDLPPHSNLT-------- 151

  Fly   282 VIGYGTVFFAGPT-STSLQKINLNVVTNQDC--------QTEYNNVATIYTGQMCTYDYSGTGRD 337
            |:|:|.:...|.. :..||:.|:.::::::|        |...||:       .|.  .....||
  Fly   152 VLGWGAINEQGHNWNQCLQEANVKLISHRECIKSVGSGWQKVTNNM-------FCA--LGKNARD 207

  Fly   338 SCQFDSGGPVILRKSRQFLVGIISYGKSCAESQYPMGVNTRIT--SYISWIRQKI 390
            :||.|||||.|.....   |||:|:|..|. |.|| ||.||::  |...|::..|
  Fly   208 ACQGDSGGPAIYAGRS---VGIVSWGYGCG-SGYP-GVYTRLSSPSITYWLKDFI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30371NP_610370.1 CUB 24..>67 CDD:294042
Tryp_SPc 149..386 CDD:214473 66/244 (27%)
Tryp_SPc 150..389 CDD:238113 67/247 (27%)
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 65/237 (27%)
Tryp_SPc 27..246 CDD:238113 65/237 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456023
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.