DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30371 and CG4927

DIOPT Version :9

Sequence 1:NP_610370.1 Gene:CG30371 / 35806 FlyBaseID:FBgn0050371 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001033953.1 Gene:CG4927 / 36852 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster


Alignment Length:346 Identity:90/346 - (26%)
Similarity:133/346 - (38%) Gaps:70/346 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 FCGSGT-----LSR---ESLF--TELVFAYISTGTKGGSFKCTL--------------------- 133
            ||.:||     ||.   .|:|  ..|:..::....|.....|.|                     
  Fly    21 FCDNGTGECKELSATDCPSIFFNLHLIRNFVKYCDKSNHIVCCLLPNNMQPQSQQFSANIGLRRF 85

  Fly   134 -------TTVKQNCNCGWSATTRIANGQQAAANEFPSMAALKDVTKNQASF---CGGTIVAHRYI 188
                   ..::.:|.    .|..|..|.:||..|||.||.|....||.:..   ||..|:..:::
  Fly    86 EKECRRFNEIRTSCR----TTPFIVGGAKAAGREFPFMALLGQRGKNSSQIDWDCGAIIIHPKFV 146

  Fly   189 LTAAHCIYQVSR-----------ATNIVAIVGTNDLGNPSSSRYYQQYNIQQMIPHEQYVSDPDV 242
            ||||||: :.|.           ....|..:|..|..:.:.....|.:.:...:.|..|..|.|.
  Fly   147 LTAAHCL-ETSETKEQRLDPNYDGPKYVVRLGELDYNSTTDDAQPQDFRVLNYVVHPAYGEDDDT 210

  Fly   243 ---NNDIAVLITASNIQWSRGVGPICLPPVGTSTPFTYDLVDVIGYGTVFFAGPTSTSLQKINLN 304
               .|||||:.......:|..|.|.|||..|.:....   |...|:|....:|..|:.|.|::|:
  Fly   211 GSRKNDIAVVELEMEATFSEYVAPACLPLDGGNEQLQ---VAAAGWGATSESGHASSHLLKVSLD 272

  Fly   305 VVTNQDCQTEYNNVATIYTGQMCTYDYSGTGRDSCQFDSGGPVILR----KSRQFLVGIISYGKS 365
            .....:|.....:...:.| |:|....| |..|:|..||||||.::    ...:.::||.|||..
  Fly   273 RYDVAECSQRLEHKIDVRT-QLCAGSRS-TSADTCYGDSGGPVFVQHPIYSCLKQVIGITSYGLV 335

  Fly   366 CAESQYPMGVNTRITSYISWI 386
            |.....| .|.|::..|..||
  Fly   336 CGVQGLP-SVYTKVHLYTDWI 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30371NP_610370.1 CUB 24..>67 CDD:294042
Tryp_SPc 149..386 CDD:214473 74/257 (29%)
Tryp_SPc 150..389 CDD:238113 76/258 (29%)
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 76/258 (29%)
Tryp_SPc 105..355 CDD:214473 74/256 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455971
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.