DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30371 and try-9

DIOPT Version :9

Sequence 1:NP_610370.1 Gene:CG30371 / 35806 FlyBaseID:FBgn0050371 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001021891.1 Gene:try-9 / 3565941 WormBaseID:WBGene00023425 Length:279 Species:Caenorhabditis elegans


Alignment Length:257 Identity:63/257 - (24%)
Similarity:94/257 - (36%) Gaps:74/257 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 GQQAAANEFPSMAALKDVTKNQASFCGGTIVAHRYILTAAHCI------------------YQVS 199
            |.:.:.|||.....             ||:|:..:|:||||.|                  |.|.
 Worm    16 GNKFSENEFVQHGT-------------GTLVSPWHIVTAAHLIGISEDPLPDCDTGNLREAYFVR 67

  Fly   200 RATNIVAIVGT-------------NDLGNPSSSRYYQQYNIQQMIPHEQYVSDPDVN----NDIA 247
            ...|.||.|..             .|:..|.:        |:.:...:.||.|..::    ||||
 Worm    68 DYKNFVAFVNVTCAVPEMCKGLHRKDMFKPLA--------IKSLYIRKGYVGDGCIDRESFNDIA 124

  Fly   248 VLITASNIQWSRGVGPICLPPVGTSTPFTYDLVDVIGYGTVFFAGPTSTSLQKINLNVVTN--QD 310
            |......|::|:.:.|.|||..............:.|||    ..|:.:.|:...|..:.:  .:
 Worm   125 VFELEEPIEFSKDIFPACLPSAPKIPRIRETGYKLFGYG----RDPSDSVLESGKLKSLYSFVAE 185

  Fly   311 CQTEYNNVATIYTGQMCTYDYSGTGRD-SCQFDSGGPVIL---RKSRQFLVGIISYGKSCAE 368
            |..::.     |.|..||   |...|. ||..|||..|:.   .::.|.|||::|.|..|.|
 Worm   186 CSDDFP-----YGGVYCT---SAVNRGLSCDGDSGSGVVRTSDTRNVQVLVGVLSAGMPCPE 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30371NP_610370.1 CUB 24..>67 CDD:294042
Tryp_SPc 149..386 CDD:214473 63/257 (25%)
Tryp_SPc 150..389 CDD:238113 63/257 (25%)
try-9NP_001021891.1 Tryp_SPc 30..237 CDD:389826 57/226 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.