DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30371 and gd

DIOPT Version :9

Sequence 1:NP_610370.1 Gene:CG30371 / 35806 FlyBaseID:FBgn0050371 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001259479.1 Gene:gd / 32159 FlyBaseID:FBgn0000808 Length:531 Species:Drosophila melanogaster


Alignment Length:468 Identity:91/468 - (19%)
Similarity:160/468 - (34%) Gaps:162/468 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LRHLPLI----SLLLFAPTVLAYFEGCDNTFNLSPGTTYVESPYYPNNYPGGTSCRYKFTAPLDY 62
            :|.|..|    |.||..|..    |....|.:..|.|.:::....|........|. :....||:
  Fly   138 IRKLSFIPDKKSSLLLDPEE----EEVRKTDDKPPSTPHIQFKKKPFAQAPKEICG-RIDRDLDF 197

  Fly    63 YI-----QVQCSLGIPKGNGQCTTDNFWLDTEGDLLMRGAENFCGSGTLSRESLFTELVFAYIST 122
            ::     .:..::|.||.:...|:..|..|.|.|:|               |..|.:        
  Fly   198 HLSQRTESLHVAIGEPKSSDGITSPVFVDDDEDDVL---------------EHQFVD-------- 239

  Fly   123 GTKGGSFKCTLTTVKQNCNCGWSATTRIANGQQAAANEFPSMAALKDVTKNQASF---CGGTIVA 184
                   :.....::.:......:.||         ..:|.:||:  ...|..|.   |||::|:
  Fly   240 -------ESEAEAIESDSADSLPSITR---------GSWPWLAAI--YVNNLTSLDFQCGGSLVS 286

  Fly   185 HRYILTAAHCIYQVSR---ATNIVAIVGTNDLGNPSSSRYYQQYNIQQMI--PHEQYVSDPDVNN 244
            .|.::::|||....::   :..::..:|.::|.|         :|.:..:  |.:.....||.|:
  Fly   287 ARVVISSAHCFKLFNKRYTSNEVLVFLGRHNLKN---------WNEEGSLAAPVDGIYIHPDFNS 342

  Fly   245 -------DIAVLITASNIQWSRGVGPICLPPVGTSTPFTYDLVD----VIGYGTVFFAGPTSTSL 298
                   ||||:|....::::..:.|.||....:.|.:   :|.    |||:.   |.....|..
  Fly   343 QLSSYDADIAVIILKDEVRFNTFIRPACLWSGSSKTEY---IVGERGIVIGWS---FDRTNRTRD 401

  Fly   299 QKINLN------------------VVTNQDC--------------------QTE----YNNVATI 321
            ||::..                  :|.|.:|                    |.|    :.:.|:|
  Fly   402 QKLSSELPGKKSTDASAPKVVKAPIVGNAECFRANAHFRSLSSNRTFCAGIQAEERDTHQSGASI 466

  Fly   322 YTGQMCTYDYSGTGRDSCQFDSGGPVILRKSRQFLVGIISYG-------------KSCAESQYPM 373
            |||      .||.|.          .|.|.:|..|.|.:|..             |.|.::||. 
  Fly   467 YTG------ISGAGL----------FIRRNNRWMLRGTVSAALPAVETPDAESSHKLCCKNQYI- 514

  Fly   374 GVNTRITSYISWI 386
             :...:..::.||
  Fly   515 -IYADVAKFLDWI 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30371NP_610370.1 CUB 24..>67 CDD:294042 7/47 (15%)
Tryp_SPc 149..386 CDD:214473 62/310 (20%)
Tryp_SPc 150..389 CDD:238113 63/311 (20%)
gdNP_001259479.1 GD_N 27..124 CDD:292649
Tryp_SPc 257..526 CDD:238113 63/312 (20%)
Tryp_SPc 258..526 CDD:214473 63/311 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456035
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.