DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30371 and Ser7

DIOPT Version :9

Sequence 1:NP_610370.1 Gene:CG30371 / 35806 FlyBaseID:FBgn0050371 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster


Alignment Length:322 Identity:91/322 - (28%)
Similarity:148/322 - (45%) Gaps:67/322 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 ISTGTKGGSFKCTLTTVK-----------------QNCNCGWSATTRIANGQQAAANEFP--SMA 165
            ||.||...:  .:.||:|                 ::..||.:.:.|:..|......|||  ::.
  Fly    87 ISNGTTNAT--SSTTTLKLLPRTTPRPPSGIDQLPEHPYCGSAFSFRLVGGHNTGLFEFPWTTLL 149

  Fly   166 ALKDVTKNQASFCGGTIVAHRYILTAAHCIYQVSRATNI-VAIVG----------TNDL-GNPSS 218
            ..:.|:..:...||.:.:|.|::|||||||:.:.|  |: .||:|          .||| |....
  Fly   150 EYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGR--NLTAAILGEWNRDTDPDCENDLNGVREC 212

  Fly   219 SRYYQQYNIQQMIPHEQYVSDPDVNNDIAVLITASNIQW--SRGVGPICLPP---------VGTS 272
            :..:.:..|.:::||.|| |:.:..||||:|..:..:.|  .:.:.|:||||         .|::
  Fly   213 APPHIRVTIDRILPHAQY-SELNYRNDIALLRLSRPVNWLQMQNLEPVCLPPQRGRYANQLAGSA 276

  Fly   273 TPFTYDLVDVIGYGTVFFAGPTSTSLQKINLNVVTNQDCQTEY--NNVATIYTGQMCTYDYSGTG 335
                   .||.|:|....:| :|...||..|::.....||..:  :...|:...|||.....|. 
  Fly   277 -------ADVSGWGKTESSG-SSKIKQKAMLHIQPQDQCQEAFYKDTKITLADSQMCAGGEIGV- 332

  Fly   336 RDSCQFDSGGPVILRKSRQ------FLVGIISYG-KSCAESQYPMGVNTRITSYISWIRQKI 390
             |||..|||||:.:..:..      :|.|::|.| |.|..:.: .|:.||::||:.||...|
  Fly   333 -DSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALF-SGIYTRVSSYMDWIESTI 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30371NP_610370.1 CUB 24..>67 CDD:294042
Tryp_SPc 149..386 CDD:214473 79/270 (29%)
Tryp_SPc 150..389 CDD:238113 80/272 (29%)
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 79/270 (29%)
Tryp_SPc 133..391 CDD:238113 80/271 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455913
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.