DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30371 and CG32260

DIOPT Version :9

Sequence 1:NP_610370.1 Gene:CG30371 / 35806 FlyBaseID:FBgn0050371 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_728942.1 Gene:CG32260 / 317943 FlyBaseID:FBgn0052260 Length:575 Species:Drosophila melanogaster


Alignment Length:284 Identity:86/284 - (30%)
Similarity:142/284 - (50%) Gaps:48/284 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 KQNCNCGWSATT--RIANGQQAAANEFPSMAAL---KDVTKNQASF-CGGTIVAHRYILTAAHCI 195
            :::..||.|..|  |:..|.:|....:|.:|||   ::..:|...| |||:::..||::|:||||
  Fly   313 RESATCGISGATSNRVVGGMEARKGAYPWIAALGYFEENNRNALKFLCGGSLIHSRYVITSAHCI 377

  Fly   196 YQVSRATNIVAIVGTNDLGNPSSSRYYQQYNIQQMIPHEQYVSDPDVN---NDIAVLITASNIQW 257
            ..:.....:    |.:||..|:.|. .....|::.:.||.:    |:|   |||| ||..:.:..
  Fly   378 NPMLTLVRL----GAHDLSQPAESG-AMDLRIRRTVVHEHF----DLNSISNDIA-LIELNVVGA 432

  Fly   258 SRG-VGPICLPP---------VGTSTPFTYDLVDVIGYGTVFFAGPTSTSLQKINLNVVTNQDCQ 312
            ..| :.|||||.         ||.: ||      |.|:|.|...|.||..|:...:.:|:...|:
  Fly   433 LPGNISPICLPEAAKFMQQDFVGMN-PF------VAGWGAVKHQGVTSQVLRDAQVPIVSRHSCE 490

  Fly   313 TEYNNV---ATIYTGQMCTYDYSGTGRDSCQFDSGGPVILRK-----SRQFLVGIISYGKSCAES 369
            ..|.::   .......:|.   ..:..|:||.|||||:::.:     .|.:|:|::|:|..||..
  Fly   491 QSYKSIFQFVQFSDKVLCA---GSSSVDACQGDSGGPLMMPQLEGNVYRFYLLGLVSFGYECARP 552

  Fly   370 QYPMGVNTRITSYISWIRQKIGNS 393
            .:| ||.||:.||:.||::.|.::
  Fly   553 NFP-GVYTRVASYVPWIKKHIASA 575

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30371NP_610370.1 CUB 24..>67 CDD:294042
Tryp_SPc 149..386 CDD:214473 79/261 (30%)
Tryp_SPc 150..389 CDD:238113 80/263 (30%)
CG32260NP_728942.1 CLIP 194..244 CDD:288855
Tryp_SPc 327..568 CDD:214473 79/261 (30%)
Tryp_SPc 328..571 CDD:238113 80/263 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456025
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.