Sequence 1: | NP_610370.1 | Gene: | CG30371 / 35806 | FlyBaseID: | FBgn0050371 | Length: | 399 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001245577.1 | Gene: | CG1632 / 31763 | FlyBaseID: | FBgn0030027 | Length: | 1056 | Species: | Drosophila melanogaster |
Alignment Length: | 389 | Identity: | 74/389 - (19%) |
---|---|---|---|
Similarity: | 119/389 - (30%) | Gaps: | 164/389 - (42%) |
- Green bases have known domain annotations that are detailed below.
Fly 142 CG-----WSATTRIANGQQAAANEFPSMAALKDVTKNQASFCGGTIVAHRYILTAAHCIYQVSRA 201
Fly 202 TNIVAIVGTNDLGNPSSSRYYQQYNIQQMIPHEQYVSDPDVNNDIAVLITASNIQWSRGVGPICL 266
Fly 267 P-------------------PVG--------------------------------TSTPFT---- 276
Fly 277 -----------------------------YDLVDVIGYGTVFFAGPTSTS--------------- 297
Fly 298 ------------------------LQKINLNVVTNQDCQTEYNNVATIYTGQMC---TYD-YSGT 334
Fly 335 GRDSCQFDSGGPV--ILRKSRQF-LVGIISYGKSCAESQYPMGVN-----TRITSYISWIRQKI 390 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG30371 | NP_610370.1 | CUB | 24..>67 | CDD:294042 | |
Tryp_SPc | 149..386 | CDD:214473 | 67/371 (18%) | ||
Tryp_SPc | 150..389 | CDD:238113 | 70/373 (19%) | ||
CG1632 | NP_001245577.1 | SEA | 232..327 | CDD:279699 | |
CRD_FZ | 384..502 | CDD:143549 | |||
PRKCSH-like | <503..>582 | CDD:193472 | |||
LDLa | 536..571 | CDD:238060 | |||
Tryp_SPc | 708..>809 | CDD:304450 | 31/112 (28%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24258 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |