DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30371 and Corin

DIOPT Version :9

Sequence 1:NP_610370.1 Gene:CG30371 / 35806 FlyBaseID:FBgn0050371 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_872279.2 Gene:Corin / 289596 RGDID:727887 Length:1111 Species:Rattus norvegicus


Alignment Length:398 Identity:95/398 - (23%)
Similarity:161/398 - (40%) Gaps:95/398 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 QVQCSLGIPKGNGQCTTDNFWLDTEGD-----------------------LLMRGA--ENFCGSG 104
            :::|:      |.:|...:.|.|...|                       .:.|.|  .:.|..|
  Rat   725 ELECA------NHECVPRDLWCDGWTDCSDSSDEWGCVTLSKNGNSSSFLTVHRSARDHHVCADG 783

  Fly   105 ---TLSR---------ESLFTELVFAYISTGTKG------------------------------G 127
               |||:         |...||||     .|.:|                              |
  Rat   784 WQETLSQLACRQMGLGEPSVTELV-----QGQEGQQWLRLHSSWENLNGSTLQELLVHRRSCPSG 843

  Fly   128 SFKCTLTTVKQNCNCGWSA--TTRIANGQQAAANEFPSMAALKDVTKNQASFCGGTIVAHRYILT 190
            | :.:|...||:|....:|  ..||..|:.:....:|...:|:  ::.....||..::|.:::||
  Rat   844 S-EISLLCTKQDCGRRPAARMNKRILGGRTSRPGRWPWQCSLQ--SEPSGHICGCVLIAKKWVLT 905

  Fly   191 AAHCIYQVSRATNIVAIVGTNDLGNPSSSRYYQQYNIQQMIPHEQYVSDPDVNNDIAVLITASNI 255
            .|||......|.....:.|.|:|.:||.  :.|...::.::.|.:| |...|:.||:|:..:.:|
  Rat   906 VAHCFEGREDADVWKVVFGINNLDHPSG--FMQTRFVKTILLHPRY-SRAVVDYDISVVELSDDI 967

  Fly   256 QWSRGVGPICLP-PVGTSTPFTYDLVDVIGYGTVFFAGPTSTSLQKINLNVVTNQDCQTEYNNVA 319
            ..:..|.|:||| |.....|.||  ..:.|:|  .........||:..:.::..:.||: |.::.
  Rat   968 NETSYVRPVCLPSPREFLEPDTY--CYITGWG--HMGNKMPFKLQEGEVRIIPLEQCQS-YFDMK 1027

  Fly   320 TIYTGQMCTYDYSGTGRDSCQFDSGGPVILRK--SRQFLVGIISYGKSCAESQYPMGVNTRITSY 382
            ||....:|....||| .|||..|||||::..:  .:..|.|:.|:|..|.......||.:.::.:
  Rat  1028 TITNRMICAGYESGT-VDSCMGDSGGPLVCERPGGQWTLFGLTSWGSVCFSKVLGPGVYSNVSYF 1091

  Fly   383 ISWIRQKI 390
            :.||.::|
  Rat  1092 VDWIERQI 1099

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30371NP_610370.1 CUB 24..>67 CDD:294042 0/1 (0%)
Tryp_SPc 149..386 CDD:214473 65/239 (27%)
Tryp_SPc 150..389 CDD:238113 66/241 (27%)
CorinNP_872279.2 DDNN motif 93..96
CRD_corin_1 200..329 CDD:143554
LDLa 335..370 CDD:238060
LDLa 372..406 CDD:238060
Ldl_recept_a 413..443 CDD:395011
LDLa 453..480 CDD:238060
CRD_corin_2 521..641 CDD:143579
Ldl_recept_a 646..680 CDD:395011
LDLa <693..718 CDD:238060
LDLa 721..755 CDD:238060 6/35 (17%)
SRCR_2 779..859 CDD:413346 18/85 (21%)
Tryp_SPc 867..1098 CDD:238113 66/241 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.