DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30371 and Sp212

DIOPT Version :9

Sequence 1:NP_610370.1 Gene:CG30371 / 35806 FlyBaseID:FBgn0050371 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster


Alignment Length:281 Identity:61/281 - (21%)
Similarity:125/281 - (44%) Gaps:64/281 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 CG--WSATTRIANGQQAAANEFPSMAAL--KDVTKNQASFCGGTIVAHRYILTAAHCIYQVSRAT 202
            ||  .|.|..|..|.:....::|.::|:  |:| :..|..|.|::::...:::||||:::::...
  Fly   267 CGREGSTTPFIVRGNEFPRGQYPWLSAVYHKEV-RALAFKCRGSLISSSIVISAAHCVHRMTEDR 330

  Fly   203 NIVAI--VGTNDLGNPSSSRYYQQYNIQQMIPHEQYVSDPDVNNDIAVLITASNIQWSRGVGPIC 265
            .:|.:  ...:|.|...:    :..|:.:::.|..|.:....:.|||::.....:.::..:.|||
  Fly   331 VVVGLGRYDLDDYGEDGA----EMRNVMRLLWHPDYNTRSYSDADIALITIERPVTFNDIIAPIC 391

  Fly   266 LPPVGTS-----TPFTYDLVDVIGYGTVFFAGPTSTSLQKINLNVVTNQDCQTEYNNV--ATIYT 323
            :..|..|     |.|      :.|:|.                   .....:|:|..|  |.|.:
  Fly   392 MWTVEASRTVSTTGF------IAGWGR-------------------DEDSSRTQYPRVVEAEIAS 431

  Fly   324 GQMCTYDYSGT-------------GRDSCQFDSGGPVILRKSRQFLV-GIISYGK-----SCAES 369
            ..:|...:.||             |...|..||||.:::::..::|: ||:|.|:     :|..:
  Fly   432 PTVCASTWRGTMVTERSLCAGNRDGSGPCVGDSGGGLMVKQGDRWLLRGIVSAGERGPAGTCQLN 496

  Fly   370 QYPMGVNTRITSYISWIRQKI 390
            ||.:..:  ::.:|:||.:.|
  Fly   497 QYVLYCD--LSKHINWISENI 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30371NP_610370.1 CUB 24..>67 CDD:294042
Tryp_SPc 149..386 CDD:214473 54/266 (20%)
Tryp_SPc 150..389 CDD:238113 56/268 (21%)
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 56/268 (21%)
Tryp_SPc 277..511 CDD:214473 54/265 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.