DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30371 and F9

DIOPT Version :9

Sequence 1:NP_610370.1 Gene:CG30371 / 35806 FlyBaseID:FBgn0050371 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_113728.1 Gene:F9 / 24946 RGDID:2589 Length:462 Species:Rattus norvegicus


Alignment Length:384 Identity:102/384 - (26%)
Similarity:171/384 - (44%) Gaps:86/384 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 GTSCRYKFTAPLDYYIQVQCSLGIPKGNGQC------TTDN--FWLDTEGDLLMRGAENF----- 100
            |.:|.          :...||:    .||:|      :.||  ....|||..|....::.     
  Rat   118 GRNCE----------LDATCSI----KNGRCKQFCKNSPDNKIICSCTEGYQLAEDQKSCEPAVP 168

  Fly   101 --CG-------SGTLSR-ESLF--------TELVFAYISTGTKGGSFKCTLTTVKQNCNCGWSAT 147
              ||       |..::| |::|        |||:...|:..|       .|..:.:|.. ..:..
  Rat   169 FPCGRVSVAYNSKKITRAETVFSNTDYGNSTELILDDITNST-------ILDNLTENSE-PINDF 225

  Fly   148 TRIANGQQAAANEFPSMAALKDVTKNQASFCGGTIVAHRYILTAAHCIYQVSRATNIVAIVGTND 212
            ||:..|:.|...:.|....|....:   :||||.|:..::|:|||||:   .....|..:.|.::
  Rat   226 TRVVGGENAKPGQIPWQVILNGEIE---AFCGGAIINEKWIVTAAHCL---KPGDKIEVVAGEHN 284

  Fly   213 LGNPSSSRYYQQYNIQQMIPHEQYVSDPDVN---NDIAVLITASNIQWSRGVGPICLPPVGTSTP 274
            :.....:.  |:.|:.:.|||.||  :..:|   :|||:|.....:..:..|.|||:    .:..
  Rat   285 IDEKEDTE--QRRNVIRTIPHHQY--NATINKYSHDIALLELDKPLILNSYVTPICV----ANKE 341

  Fly   275 FTYDLVD-----VIGYGTVFFAGPTSTSLQKINLNVVTNQDC--QTEYNNVATIYTGQMCTYDYS 332
            :|...:.     |.|:|.||..|..::.||.:.:.:|....|  .|::    :||....|. .|.
  Rat   342 YTNIFLKFGSGYVSGWGKVFNKGRQASILQYLRVPLVDRATCLRSTKF----SIYNNMFCA-GYR 401

  Fly   333 GTGRDSCQFDSGGPVILR-KSRQFLVGIISYGKSCA-ESQYPMGVNTRITSYISWIRQK 389
            ..|:|||:.|||||.:.. :...||.||||:|:.|| :.:|  |:.|:::.|::||::|
  Rat   402 EGGKDSCEGDSGGPHVTEVEGTSFLTGIISWGEECAMKGKY--GIYTKVSRYVNWIKEK 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30371NP_610370.1 CUB 24..>67 CDD:294042 2/17 (12%)
Tryp_SPc 149..386 CDD:214473 72/248 (29%)
Tryp_SPc 150..389 CDD:238113 73/250 (29%)
F9NP_113728.1 GLA 21..85 CDD:214503
EGF_CA 86..122 CDD:238011 1/3 (33%)
FXa_inhibition 127..163 CDD:291342 11/39 (28%)
Tryp_SPc 227..455 CDD:214473 72/248 (29%)
Tryp_SPc 228..458 CDD:238113 73/250 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.