DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30371 and CG30002

DIOPT Version :9

Sequence 1:NP_610370.1 Gene:CG30371 / 35806 FlyBaseID:FBgn0050371 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001163100.1 Gene:CG30002 / 246384 FlyBaseID:FBgn0260474 Length:311 Species:Drosophila melanogaster


Alignment Length:266 Identity:70/266 - (26%)
Similarity:118/266 - (44%) Gaps:47/266 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 IANGQQAAANEFPSMAALKDVTKNQASFCGGTIVAHRYILTAAHCIYQVSRATNIVAIVGTNDLG 214
            |..|::::....|.||.|...:..:...|||::::..::||||||.....|:..|...:|..||.
  Fly    62 ITGGRKSSLMSQPWMAFLHIASDLEMCRCGGSLISELFVLTAAHCFKMCPRSKEIRVWLGELDLS 126

  Fly   215 NPSSSRYY----------QQYNIQQMIPHEQY-VSDPDVNNDIAVLITASNIQWSRGVGPICLPP 268
            :.|....|          :::.|.:.|.||:: :..|  ..|||::.....:.:...:.|||||.
  Fly   127 STSDCTTYNYERVCAPPVEEFTIDKWILHEEFNLFYP--GYDIALIKLNKKVVFKDHIRPICLPL 189

  Fly   269 VGTSTPFTYDLVD---VIGYGTVFFAGPTSTSLQKINLNV---VTNQDCQTEYNNVATIYTGQMC 327
            ......||..|..   .:|:|       .:.||:..|..:   :..:.| |:..:     |..:|
  Fly   190 TDELLAFTLQLGQRFMAVGWG-------KTESLRYANSTMEVDIRTEKC-TDGRD-----TSFLC 241

  Fly   328 TYDYSGTGRDSCQFDSGGPVILR-----KSRQFLVGIISYG-KSC--AESQYPMGVNTRITSYIS 384
            .   ||...|:|..|||||::.:     |.|....|::|.| ::|  ....|.|.|.|    |:.
  Fly   242 A---SGDYVDTCNGDSGGPLLWKTTLFGKDRAVQFGVVSTGSQNCGAGHKAYYMDVPT----YMP 299

  Fly   385 WIRQKI 390
            ||.:|:
  Fly   300 WILEKM 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30371NP_610370.1 CUB 24..>67 CDD:294042
Tryp_SPc 149..386 CDD:214473 67/260 (26%)
Tryp_SPc 150..389 CDD:238113 69/263 (26%)
CG30002NP_001163100.1 Tryp_SPc 62..301 CDD:214473 67/260 (26%)
Tryp_SPc 62..301 CDD:238113 67/260 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455996
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.