DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30371 and Masp2

DIOPT Version :9

Sequence 1:NP_610370.1 Gene:CG30371 / 35806 FlyBaseID:FBgn0050371 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001003893.1 Gene:Masp2 / 17175 MGIID:1330832 Length:685 Species:Mus musculus


Alignment Length:378 Identity:97/378 - (25%)
Similarity:155/378 - (41%) Gaps:90/378 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PNNYPGGTSCRYKFTAPLDY-----------YIQVQC--SLGIPKGNGQ--CTTDNFWLDTEGDL 92
            |::.|.|         .:||           .||..|  :......||:  |..|.||..::|:.
Mouse   369 PDDLPNG---------HVDYITGPEVTTYKAVIQYSCEETFYTMSSNGKYVCEADGFWTSSKGEK 424

  Fly    93 LMRGAENFCGSGTLSRESLFTELVFAYISTGTKGGSFKCTLTTVKQNCNCGWSATTRIANGQQAA 157
            |....|..||                 :||.|.||                     ||..||.|.
Mouse   425 LPPVCEPVCG-----------------LSTHTIGG---------------------RIVGGQPAK 451

  Fly   158 ANEFPSMAALKDVTKNQASFCGGTIVAHRYILTAAHCIYQVSRATNIVAI-VGTNDLGNPSSSRY 221
            ..:||....|    ..|.:...|.::...::|||||.:|:...|.:.:.| :|.....:|    :
Mouse   452 PGDFPWQVLL----LGQTTAAAGALIHDNWVLTAAHAVYEKRMAASSLNIRMGILKRLSP----H 508

  Fly   222 YQQYNIQQMIPHEQYVSDPDVNNDIAVLITASNIQWSRGVGPICLPPVGTSTPFTYDLV-DVIGY 285
            |.|...:::..||.|......:||||::...:.:..:..:.|:|||....::....|.. .|.|:
Mouse   509 YTQAWPEEIFIHEGYTHGAGFDNDIALIKLKNKVTINGSIMPVCLPRKEAASLMRTDFTGTVAGW 573

  Fly   286 GTVFFAGPTSTSLQKINLNVVTNQDCQTEYNNVATIYTG------QMCTYDYSGTGRDSCQFDSG 344
            | :...|..:.:|..:::.:..:|.|...|..   :|.|      .:|....:| |:|||:.|||
Mouse   574 G-LTQKGLLARNLMFVDIPIADHQKCTAVYEK---LYPGVRVSANMLCAGLETG-GKDSCRGDSG 633

  Fly   345 GPVIL---RKSRQFLVGIISYGK-SC-AESQYPMGVNTRITSYISWIRQKIGN 392
            |.::.   ...|.|:.||:|:|. :| |..||  ||.|::.:||.||...|.|
Mouse   634 GALVFLDNETQRWFVGGIVSWGSINCGAADQY--GVYTKVINYIPWIENIISN 684

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30371NP_610370.1 CUB 24..>67 CDD:294042 7/34 (21%)
Tryp_SPc 149..386 CDD:214473 69/249 (28%)
Tryp_SPc 150..389 CDD:238113 70/251 (28%)
Masp2NP_001003893.1 CUB 19..136 CDD:238001
FXa_inhibition 152..180 CDD:291342
CUB 184..293 CDD:278839
Sushi 300..361 CDD:278512
Sushi 366..429 CDD:278512 16/68 (24%)
Tryp_SPc 443..678 CDD:214473 69/249 (28%)
Tryp_SPc 444..681 CDD:238113 70/251 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.