DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30371 and MASP2

DIOPT Version :9

Sequence 1:NP_610370.1 Gene:CG30371 / 35806 FlyBaseID:FBgn0050371 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_006601.2 Gene:MASP2 / 10747 HGNCID:6902 Length:686 Species:Homo sapiens


Alignment Length:417 Identity:112/417 - (26%)
Similarity:175/417 - (41%) Gaps:97/417 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 HLPLISLLLFAPTVLAYFEGC-DNTFNLSPGTTYVE-SPYYPNNYPGGTSCRYKF-TAP-LDYY- 63
            ||||.|.     |.:...:|. |...   |..:.|: .|  |::.|.|   |.:: |.| :..| 
Human   338 HLPLKSF-----TAVCQKDGSWDRPM---PACSIVDCGP--PDDLPSG---RVEYITGPGVTTYK 389

  Fly    64 --IQVQC-----SLGIPKGNGQCTTDNFWLDTEGDLLMRGAENFCGSGTLSRESLFTELVFAYIS 121
              ||..|     ::.:..|...|..|.||..::|:..:...|..||                 :|
Human   390 AVIQYSCEETFYTMKVNDGKYVCEADGFWTSSKGEKSLPVCEPVCG-----------------LS 437

  Fly   122 TGTKGGSFKCTLTTVKQNCNCGWSATTRIANGQQAAANEFPSMAALKDVTKNQASFCGGTIVA-- 184
            ..|.||                     ||..||:|...:||.          |....|||..|  
Human   438 ARTTGG---------------------RIYGGQKAKPGDFPW----------QVLILGGTTAAGA 471

  Fly   185 ---HRYILTAAHCIYQVSRATNIVAI-VGTNDLGNPSSSRYYQQYNIQQMIPHEQYVSDPDVNND 245
               ..::|||||.:|:.....:.:.| :||....:|    :|.|...:.:..||.|..|...:||
Human   472 LLYDNWVLTAAHAVYEQKHDASALDIRMGTLKRLSP----HYTQAWSEAVFIHEGYTHDAGFDND 532

  Fly   246 IAVLITASNIQWSRGVGPICLP-PVGTSTPFTYDLVDVIGYGTVFFAGPTSTSLQKINLNVVTNQ 309
            ||::...:.:..:..:.||||| ....|...|.|:....|:| :...|..:.:|..:::.:|.:|
Human   533 IALIKLNNKVVINSNITPICLPRKEAESFMRTDDIGTASGWG-LTQRGFLARNLMYVDIPIVDHQ 596

  Fly   310 DCQTEYNNV----ATIYTGQMCTYDYSGTGRDSCQFDSGGPVILRKS---RQFLVGIISYGK-SC 366
            .|...|...    .::....:|....|| |:|||:.||||.::...|   |.|:.||:|:|. :|
Human   597 KCTAAYEKPPYPRGSVTANMLCAGLESG-GKDSCRGDSGGALVFLDSETERWFVGGIVSWGSMNC 660

  Fly   367 AES-QYPMGVNTRITSYISWIRQKIGN 392
            .|: ||  ||.|::.:||.||...|.:
Human   661 GEAGQY--GVYTKVINYIPWIENIISD 685

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30371NP_610370.1 CUB 24..>67 CDD:294042 13/49 (27%)
Tryp_SPc 149..386 CDD:214473 75/252 (30%)
Tryp_SPc 150..389 CDD:238113 76/254 (30%)
MASP2NP_006601.2 CUB 28..134 CDD:214483
EGF_CA 138..176 CDD:214542
CUB 184..293 CDD:278839
CCP 300..361 CDD:214478 9/30 (30%)
Sushi 366..430 CDD:278512 17/68 (25%)
Tryp_SPc 444..679 CDD:214473 75/252 (30%)
Tryp_SPc 445..682 CDD:238113 76/254 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.