DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30371 and CORIN

DIOPT Version :9

Sequence 1:NP_610370.1 Gene:CG30371 / 35806 FlyBaseID:FBgn0050371 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_006578.2 Gene:CORIN / 10699 HGNCID:19012 Length:1042 Species:Homo sapiens


Alignment Length:404 Identity:97/404 - (24%)
Similarity:165/404 - (40%) Gaps:88/404 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 DYYIQVQCSL----GIPKGNGQCTTDNFWLDTEGD-----------------------LLMRGA- 97
            ||..:..||.    .:...|..|.:.:.|.|.|.|                       ::.|.| 
Human   645 DYMDEKNCSFCQDDELECANHACVSRDLWCDGEADCSDSSDEWDCVTLSINVNSSSFLMVHRAAT 709

  Fly    98 -ENFCGSGTLSRESLFTELVFAYISTG----TK-------------------------------- 125
             .:.|..|.   :.:.::|....:..|    ||                                
Human   710 EHHVCADGW---QEILSQLACKQMGLGEPSVTKLIQEQEKEPRWLTLHSNWESLNGTTLHELLVN 771

  Fly   126 GGS----FKCTLTTVKQNCNCGWSA--TTRIANGQQAAANEFPSMAALKDVTKNQASFCGGTIVA 184
            |.|    .|.:|...||:|....:|  ..||..|:.:....:|...:|:  ::.....||..::|
Human   772 GQSCESRSKISLLCTKQDCGRRPAARMNKRILGGRTSRPGRWPWQCSLQ--SEPSGHICGCVLIA 834

  Fly   185 HRYILTAAHCIYQVSRATNIVAIVGTNDLGNPSSSRYYQQYNIQQMIPHEQYVSDPDVNNDIAVL 249
            .:::||.|||......|.....::|.|:|.:||.  :.|...::.:|.|.:| |...|:.||:::
Human   835 KKWVLTVAHCFEGRENAAVWKVVLGINNLDHPSV--FMQTRFVKTIILHPRY-SRAVVDYDISIV 896

  Fly   250 ITASNIQWSRGVGPICLP-PVGTSTPFTYDLVDVIGYGTVFFAGPTSTSLQKINLNVVTNQDCQT 313
            ..:.:|..:..|.|:||| |.....|.||  ..:.|:|  .........||:..:.:::.:.||:
Human   897 ELSEDISETGYVRPVCLPNPEQWLEPDTY--CYITGWG--HMGNKMPFKLQEGEVRIISLEHCQS 957

  Fly   314 EYNNVATIYTGQMCTYDYSGTGRDSCQFDSGGPVILRK--SRQFLVGIISYGKSCAESQYPMGVN 376
             |.::.||.|..:|....||| .|||..|||||::..|  .|..|.|:.|:|..|.......||.
Human   958 -YFDMKTITTRMICAGYESGT-VDSCMGDSGGPLVCEKPGGRWTLFGLTSWGSVCFSKVLGPGVY 1020

  Fly   377 TRITSYISWIRQKI 390
            :.::.::.||:::|
Human  1021 SNVSYFVEWIKRQI 1034

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30371NP_610370.1 CUB 24..>67 CDD:294042 2/5 (40%)
Tryp_SPc 149..386 CDD:214473 68/239 (28%)
Tryp_SPc 150..389 CDD:238113 69/241 (29%)
CORINNP_006578.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
DDNN motif 26..29
CRD_corin_1 135..263 CDD:143554
LDLa 269..304 CDD:238060
LDLa 306..340 CDD:238060
Ldl_recept_a 347..377 CDD:278486
LDLa 387..414 CDD:238060
CRD_corin_2 454..575 CDD:143579
LDLa 580..614 CDD:238060
LDLa 655..689 CDD:238060 6/33 (18%)
SR 690..786 CDD:214555 12/98 (12%)
Tryp_SPc 801..1030 CDD:214473 68/239 (28%)
Tryp_SPc 802..1033 CDD:238113 69/241 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.