DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14760 and C1R

DIOPT Version :9

Sequence 1:NP_610366.1 Gene:CG14760 / 35802 FlyBaseID:FBgn0033277 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_001341275.1 Gene:C1R / 715 HGNCID:1246 Length:719 Species:Homo sapiens


Alignment Length:575 Identity:124/575 - (21%)
Similarity:211/575 - (36%) Gaps:138/575 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QCNHQVKLQ-SGQKLLINSPYYPALYPVGTSCRYAVEAPKDHVLQFKCELQLRTLSTD----LKC 81
            :|:.::..: ||   .|:|..||..||....|.|::...:...|..|.   |.....|    :.|
Human   206 ECSSELYTEASG---YISSLEYPRSYPPDLRCNYSIRVERGLTLHLKF---LEPFDIDDHQQVHC 264

  Fly    82 RTEVFHFNSEGDEVLTSSEYFCGSGKFERKSFLNRAVISYISSGHSEPPSAVKLKDKLHAVPTTS 146
            ..:.....:.|..:    ..|||..:.......:.||.....:..|......||:       .|:
Human   265 PYDQLQIYANGKNI----GEFCGKQRPPDLDTSSNAVDLLFFTDESGDSRGWKLR-------YTT 318

  Fly   147 TTTEAPQAVSIEEQDAEEEQEEEEEPEEADEDL-------------SDEVLH----VLQDVGVSD 194
            ...:.||..:::|....:..    :|:....|.             .::|||    |.||.|...
Human   319 EIIKCPQPKTLDEFTIIQNL----QPQYQFRDYFIATCKQGYQLIEGNQVLHSFTAVCQDDGTWH 379

  Fly   195 ALAYVASLLYDVEESR-------KSSTTIYLD---------------KLPIRSSSKTSAKRARIV 237
            . |.....:.|..:.|       :.:||:.::               |:..|:.|:.|.:     
Human   380 R-AMPRCKIKDCGQPRNLPNGDFRYTTTMGVNTYKARIQYYCHEPYYKMQTRAGSRESEQ----- 438

  Fly   238 SSYPTAAPSPGHGGGRFSCLVEAFQ---------PTCSCGWSRIPRIASPTN-----------EE 282
                          |.::|..:...         |.|      :|....|.|           ::
Human   439 --------------GVYTCTAQGIWKNEQKGEKIPRC------LPVCGKPVNPVEQRQRIIGGQK 483

  Fly   283 AVLHEFPPMAGVLTKKHGKVFCGAAIIHHRYLLSAAHCFLGP---ETNSAAKLRVVVGEHDLASS 344
            |.:..||..  |.|..||:  .|.|::..|::|:|||. |.|   |..|.|.|.|.:|..::.  
Human   484 AKMGNFPWQ--VFTNIHGR--GGGALLGDRWILTAAHT-LYPKEHEAQSNASLDVFLGHTNVE-- 541

  Fly   345 FETFATQRYDLDALILHEDFSQ-ASGQPKNDIAMLKTRMAIVWSQHVGPACLPLQPGEDGQKLPL 408
             |......:.:..:.:|.|:.| .|...:.|||:|:...::....::.|.|||  ..:....|.|
Human   542 -ELMKLGNHPIRRVSVHPDYRQDESYNFEGDIALLELENSVTLGPNLLPICLP--DNDTFYDLGL 603

  Fly   409 AGHQVVAAGWGTTSYGGPQTHRLLKATLDVIDGRRCRQALSSAGGL---PPHTFCTYTPG--RDT 468
            .|:   .:|:|...  ....|.|....|.|.:.:.|...|.....:   ..:.||...|.  :|.
Human   604 MGY---VSGFGVME--EKIAHDLRFVRLPVANPQACENWLRGKNRMDVFSQNMFCAGHPSLKQDA 663

  Fly   469 CQYDSGG--ALYERINGRLMAVGIVSFGQACAAQQPSVNTRVASFIKWIRTKSPE 521
            ||.||||  |:.:....|.:|.||||:|..| ::.....|:|.:::.||:.:..|
Human   664 CQGDSGGVFAVRDPNTDRWVATGIVSWGIGC-SRGYGFYTKVLNYVDWIKKEMEE 717

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14760NP_610366.1 CUB 37..126 CDD:294042 19/92 (21%)
Tryp_SPc 281..516 CDD:238113 68/245 (28%)
Tryp_SPc 281..515 CDD:214473 67/244 (27%)
C1RNP_001341275.1 CUB 41..152 CDD:214483
FXa_inhibition 175..203 CDD:317114
CUB 207..316 CDD:278839 25/125 (20%)
Sushi 323..385 CDD:306569 13/66 (20%)
Sushi 390..461 CDD:306569 10/89 (11%)
Tryp_SPc 477..711 CDD:214473 67/249 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.