DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14760 and CG34437

DIOPT Version :9

Sequence 1:NP_610366.1 Gene:CG14760 / 35802 FlyBaseID:FBgn0033277 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster


Alignment Length:242 Identity:49/242 - (20%)
Similarity:103/242 - (42%) Gaps:45/242 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   284 VLHEFPPMAGVL--TKKHGKVFCGAAIIHHRYLLSAAHCFLGPETNSAAKLRVVVGEHD-LASSF 345
            |..|.|.||.:.  ||.     |...:|:.:|:::.|.|......::     |.:|..| :..:.
  Fly    36 VFKETPWMAFIASPTKN-----CSGTLINKQYVITTASCVFDQSEST-----VFLGRFDNIPQNR 90

  Fly   346 ETFATQRYDLDALILHEDFSQASGQPKNDIAMLKTRMAIVWSQHVGPACLPLQPGEDGQKLPLAG 410
            ..:.  ::.:.::..|:.:::.:.:  :|||:|.....:.:...:.|.|:.|  ||......|..
  Fly    91 NRYV--KHSVQSVYTHKLYNKQTFE--HDIALLLLDDPVTFKMSIQPICIWL--GEITNLNHLES 149

  Fly   411 HQVVAAGWGTTS---YGGPQTHRLLKATLDVIDGRRCRQALSSAGGLPPHTFCTYTPGRDTCQYD 472
            ::     ||.:.   :....|.::||.       ::||.:....  |.....|......:.|. :
  Fly   150 NR-----WGLSEKMIFQRINTVKILKI-------KKCRDSFGIT--LKKSQICAGFQNGNICT-E 199

  Fly   473 SGGALYERI--NGRL--MAVGIVSFGQACAAQQPSVNTRVASFIKWI 515
            :|.:|.::|  :|:|  ..:||.|:|    ..:..:..::|.:|.||
  Fly   200 TGSSLVKQIHYSGKLWNTLIGIQSYG----VSERCIYNKIAHYIDWI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14760NP_610366.1 CUB 37..126 CDD:294042
Tryp_SPc 281..516 CDD:238113 49/242 (20%)
Tryp_SPc 281..515 CDD:214473 47/240 (20%)
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 46/237 (19%)
Tryp_SPc 39..242 CDD:304450 46/237 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455906
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.